DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and ZNF223

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_037493.3 Gene:ZNF223 / 7766 HGNCID:13016 Length:482 Species:Homo sapiens


Alignment Length:156 Identity:46/156 - (29%)
Similarity:65/156 - (41%) Gaps:40/156 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 YTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICER 375
            |.||.|||.|.||:.|..|.|.||||:||||..|.:|:...|.|..|.| .|..|||:.|:.|.:
Human   344 YNCKECGKSFRRSSYLLIHQRVHTGEKPYKCDKCGKSYITKSGLDLHHR-AHTGERPYNCDDCGK 407

  Fly   376 CFGQQTNLDRHLKKHESDAVSLSALSGVSERMHCIRR--FCENPTEESYFEEIRSFMGKVTQQQQ 438
            .|.|.:::..|                  :|:||.::  .||:..::..:...|.          
Human   408 SFRQASSILNH------------------KRLHCRKKPFKCEDCGKKLVYRSYRK---------- 444

  Fly   439 QQQQQQQHDQQQQQHQSTATSASSSC 464
                     .||:.|.....|....|
Human   445 ---------DQQKNHSGENPSKCEDC 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 26/51 (51%)
zf-C2H2 311..333 CDD:278523 12/21 (57%)
C2H2 Zn finger 313..333 CDD:275368 11/19 (58%)
zf-H2C2_2 325..349 CDD:290200 13/23 (57%)
C2H2 Zn finger 341..362 CDD:275368 7/20 (35%)
zf-H2C2_2 353..377 CDD:290200 9/23 (39%)
zf-C2H2 368..390 CDD:278523 5/21 (24%)
C2H2 Zn finger 370..390 CDD:275368 5/19 (26%)
ZNF223NP_037493.3 KRAB 8..67 CDD:214630
KRAB 8..47 CDD:279668
COG5048 <139..380 CDD:227381 21/35 (60%)
C2H2 Zn finger 150..170 CDD:275368
C2H2 Zn finger 178..198 CDD:275368
C2H2 Zn finger 206..226 CDD:275368
zf-H2C2_2 218..243 CDD:290200
C2H2 Zn finger 234..254 CDD:275368
C2H2 Zn finger 262..282 CDD:275368
zf-H2C2_2 275..297 CDD:290200
C2H2 Zn finger 294..310 CDD:275370
C2H2 Zn finger 322..338 CDD:275368
zf-H2C2_2 333..355 CDD:290200 7/10 (70%)
C2H2 Zn finger 346..366 CDD:275368 11/19 (58%)
zf-H2C2_2 358..383 CDD:290200 13/24 (54%)
C2H2 Zn finger 374..394 CDD:275368 7/20 (35%)
C2H2 Zn finger 402..422 CDD:275368 6/37 (16%)
C2H2 Zn finger 430..450 CDD:275368 5/38 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.