Sequence 1: | NP_001286059.1 | Gene: | CG10348 / 35132 | FlyBaseID: | FBgn0032707 | Length: | 540 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001123992.1 | Gene: | ZNF195 / 7748 | HGNCID: | 12986 | Length: | 629 | Species: | Homo sapiens |
Alignment Length: | 263 | Identity: | 71/263 - (26%) |
---|---|---|---|
Similarity: | 109/263 - (41%) | Gaps: | 85/263 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 191 QCSIPAVHPTLLEAMTKNLPLQYR---NVFAG---------VLPGKVNSPAASSSPTGADFPFRH 243
Fly 244 PLKKCELTW-------PPPTEQLQLELPHPNPK----------LSPVLPHPQL----QDYQTRRK 287
Fly 288 NKARTAA----------TGG---------------NATPNLPQRNKDR--YTCKFCGKVFPRSAN 325
Fly 326 LTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKKH 390
Fly 391 ESD 393 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10348 | NP_001286059.1 | COG5048 | 300..>363 | CDD:227381 | 28/64 (44%) |
zf-C2H2 | 311..333 | CDD:278523 | 9/21 (43%) | ||
C2H2 Zn finger | 313..333 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 325..349 | CDD:290200 | 13/23 (57%) | ||
C2H2 Zn finger | 341..362 | CDD:275368 | 9/20 (45%) | ||
zf-H2C2_2 | 353..377 | CDD:290200 | 13/23 (57%) | ||
zf-C2H2 | 368..390 | CDD:278523 | 8/21 (38%) | ||
C2H2 Zn finger | 370..390 | CDD:275368 | 7/19 (37%) | ||
ZNF195 | NP_001123992.1 | KRAB | 4..64 | CDD:214630 | |
KRAB | 4..43 | CDD:279668 | |||
Spacer | 76..243 | ||||
COG5048 | 225..629 | CDD:227381 | 71/263 (27%) | ||
C2H2 Zn finger | 246..266 | CDD:275368 | |||
C2H2 Zn finger | 274..294 | CDD:275368 | |||
C2H2 Zn finger | 302..345 | CDD:275368 | 5/10 (50%) | ||
C2H2 Zn finger | 384..404 | CDD:275368 | 6/20 (30%) | ||
C2H2 Zn finger | 412..432 | CDD:275368 | 2/19 (11%) | ||
zf-H2C2_2 | 424..449 | CDD:290200 | 4/24 (17%) | ||
C2H2 Zn finger | 440..460 | CDD:275368 | 3/19 (16%) | ||
zf-H2C2_2 | 452..477 | CDD:290200 | 2/24 (8%) | ||
C2H2 Zn finger | 468..488 | CDD:275368 | 1/19 (5%) | ||
zf-H2C2_2 | 480..505 | CDD:290200 | 7/24 (29%) | ||
C2H2 Zn finger | 496..516 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 508..533 | CDD:290200 | 14/24 (58%) | ||
C2H2 Zn finger | 524..544 | CDD:275368 | 9/20 (45%) | ||
zf-H2C2_2 | 536..559 | CDD:290200 | 13/23 (57%) | ||
C2H2 Zn finger | 552..572 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 567..589 | CDD:290200 | 3/9 (33%) | ||
C2H2 Zn finger | 580..600 | CDD:275368 | |||
zf-H2C2_2 | 592..617 | CDD:290200 | |||
C2H2 Zn finger | 608..628 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |