| Sequence 1: | NP_001286059.1 | Gene: | CG10348 / 35132 | FlyBaseID: | FBgn0032707 | Length: | 540 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001333510.1 | Gene: | ZKSCAN1 / 7586 | HGNCID: | 13101 | Length: | 563 | Species: | Homo sapiens |
| Alignment Length: | 259 | Identity: | 69/259 - (26%) |
|---|---|---|---|
| Similarity: | 110/259 - (42%) | Gaps: | 49/259 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 255 PTEQLQLELPHPNPKLSPVLPHPQLQDYQT-------RRKNK--ARTAATGGN-ATPNLPQRNKD 309
Fly 310 RYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICE 374
Fly 375 RCFGQQTNLDRHLKKHESD----------AVSLSALSGVSERMHCIRRFCENPTEESYFEEIRSF 429
Fly 430 MGKVTQQQQQQQQQQQHDQQQQQHQSTATSASSSCSSSRDTPTSSH------EEADHAPATSTA 487 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10348 | NP_001286059.1 | COG5048 | 300..>363 | CDD:227381 | 28/62 (45%) |
| zf-C2H2 | 311..333 | CDD:278523 | 10/21 (48%) | ||
| C2H2 Zn finger | 313..333 | CDD:275368 | 10/19 (53%) | ||
| zf-H2C2_2 | 325..349 | CDD:290200 | 11/23 (48%) | ||
| C2H2 Zn finger | 341..362 | CDD:275368 | 9/20 (45%) | ||
| zf-H2C2_2 | 353..377 | CDD:290200 | 10/23 (43%) | ||
| zf-C2H2 | 368..390 | CDD:278523 | 6/21 (29%) | ||
| C2H2 Zn finger | 370..390 | CDD:275368 | 6/19 (32%) | ||
| ZKSCAN1 | NP_001333510.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..51 | ||
| SCAN | 52..162 | CDD:128708 | |||
| KRAB_A-box | 227..262 | CDD:143639 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 257..373 | 13/61 (21%) | |||
| C2H2 Zn finger | 355..371 | CDD:275368 | 4/15 (27%) | ||
| COG5048 | <356..537 | CDD:227381 | 56/195 (29%) | ||
| C2H2 Zn finger | 379..399 | CDD:275368 | 10/19 (53%) | ||
| C2H2 Zn finger | 407..427 | CDD:275368 | 9/20 (45%) | ||
| C2H2 Zn finger | 435..455 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 463..483 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 491..511 | CDD:275368 | 3/19 (16%) | ||
| C2H2 Zn finger | 519..539 | CDD:275368 | 6/22 (27%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||