DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10348 and ZNF12

DIOPT Version :9

Sequence 1:	NP_001286059.1	Gene:	CG10348 / 35132	FlyBaseID:	FBgn0032707	Length:	540	Species:	Drosophila melanogaster
Sequence 2:	NP_057349.2	Gene:	ZNF12 / 7559	HGNCID:	12902	Length:	697	Species:	Homo sapiens

Alignment Length:	122	Identity:	44/122 - (36%)
Similarity:	66/122 - (54%)	Gaps:	12/122 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly   311 YTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICER 375
            |.|..|||.|.:..:|.:|.|||:||:||:|.||.:||...::|.:|.|. |:.|||:.|..|.:
Human   325 YECNECGKNFYQKLHLIQHQRTHSGEKPYECSYCGKSFCQKTHLTQHQRT-HSGERPYVCHDCGK 388

  Fly   376 CFGQQTNLDRHLKKHESDAVSLSALSGVSERMHCIRRFCENPTEESYFEEIRSFMGK 432
            .|.|::.|:.|.|.|  ..|.|...|      .|.:.||...|..::   :|:..|:
Human   389 TFSQKSALNDHQKIH--TGVKLYKCS------ECGKCFCRKSTLTTH---LRTHTGE 434

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10348	NP_001286059.1	COG5048	300..>363	CDD:227381	23/51 (45%)
		zf-C2H2	311..333	CDD:278523	9/21 (43%)
		C2H2 Zn finger	313..333	CDD:275368	8/19 (42%)
		zf-H2C2_2	325..349	CDD:290200	13/23 (57%)
		C2H2 Zn finger	341..362	CDD:275368	8/20 (40%)
		zf-H2C2_2	353..377	CDD:290200	9/23 (39%)
		zf-C2H2	368..390	CDD:278523	7/21 (33%)
		C2H2 Zn finger	370..390	CDD:275368	7/19 (37%)
ZNF12	NP_057349.2	KRAB	8..68	CDD:214630
		KRAB	8..47	CDD:279668
		C2H2 Zn finger	271..291	CDD:275368
		zf-H2C2_2	287..306	CDD:290200
		C2H2 Zn finger	299..319	CDD:275368
		COG5048	307..683	CDD:227381	44/122 (36%)
		zf-H2C2_2	312..334	CDD:290200	5/8 (63%)
		C2H2 Zn finger	327..347	CDD:275368	8/19 (42%)
		zf-H2C2_2	339..362	CDD:290200	12/22 (55%)
		C2H2 Zn finger	355..375	CDD:275368	8/20 (40%)
		zf-H2C2_2	367..392	CDD:290200	10/25 (40%)
		C2H2 Zn finger	383..403	CDD:275368	7/19 (37%)
		C2H2 Zn finger	439..459	CDD:275368
		zf-H2C2_2	451..474	CDD:290200
		C2H2 Zn finger	467..487	CDD:275368
		zf-H2C2_2	479..504	CDD:290200
		C2H2 Zn finger	495..515	CDD:275368
		C2H2 Zn finger	523..543	CDD:275368
		zf-H2C2_2	538..560	CDD:290200
		C2H2 Zn finger	551..571	CDD:275368
		zf-H2C2_2	563..586	CDD:290200
		zf-C2H2	577..599	CDD:278523
		C2H2 Zn finger	579..599	CDD:275368
		zf-H2C2_2	591..616	CDD:290200
		C2H2 Zn finger	607..627	CDD:275368
		zf-H2C2_2	619..644	CDD:290200
		C2H2 Zn finger	635..655	CDD:275368
		zf-H2C2_2	647..670	CDD:290200
		C2H2 Zn finger	663..683	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910