DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10348 and ZNF711

DIOPT Version :9

Sequence 1:	NP_001286059.1	Gene:	CG10348 / 35132	FlyBaseID:	FBgn0032707	Length:	540	Species:	Drosophila melanogaster
Sequence 2:	XP_011529321.1	Gene:	ZNF711 / 7552	HGNCID:	13128	Length:	811	Species:	Homo sapiens

Alignment Length:	146	Identity:	48/146 - (32%)
Similarity:	71/146 - (48%)	Gaps:	23/146 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly   255 PTEQLQLELPHPNPKLSPVLPHPQLQDYQTRRK---NKARTAATGGNATPNLPQRNKDRYTCKFC 316
            |....:|.|....||:...    :..||:|..:   |:...|.    .:.|.|      :.|..|
Human   510 PLSSNKLILRDKEPKMHKC----KYCDYETAEQGLLNRHLLAV----HSKNFP------HVCVEC 560

  Fly   317 GKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQT 381
            ||.|...:.|.:|:||||||:||:|:||....:..|||:.|:::.|....|:|||.|.:.||.:.
Human   561 GKGFRHPSELKKHMRTHTGEKPYQCQYCIFRCADQSNLKTHIKSKHGNNLPYKCEHCPQAFGDER 625

  Fly   382 NLDRHL------KKHE 391
            .|.|||      |.|:
Human   626 ELQRHLDLFQGHKTHQ 641

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10348	NP_001286059.1	COG5048	300..>363	CDD:227381	24/62 (39%)
		zf-C2H2	311..333	CDD:278523	8/21 (38%)
		C2H2 Zn finger	313..333	CDD:275368	8/19 (42%)
		zf-H2C2_2	325..349	CDD:290200	13/23 (57%)
		C2H2 Zn finger	341..362	CDD:275368	7/20 (35%)
		zf-H2C2_2	353..377	CDD:290200	9/23 (39%)
		zf-C2H2	368..390	CDD:278523	11/27 (41%)
		C2H2 Zn finger	370..390	CDD:275368	10/25 (40%)
ZNF711	XP_011529321.1	Zfx_Zfy_act	69..418	CDD:282547
		COG5048	<426..604	CDD:227381	34/107 (32%)
		zf-C2H2	433..455	CDD:278523
		C2H2 Zn finger	435..455	CDD:275368
		C2H2 Zn finger	528..549	CDD:275368	5/28 (18%)
		COG5048	550..>807	CDD:227381	38/98 (39%)
		zf-C2H2	555..577	CDD:278523	8/21 (38%)
		C2H2 Zn finger	557..577	CDD:275368	8/19 (42%)
		zf-H2C2_2	569..593	CDD:290200	13/23 (57%)
		C2H2 Zn finger	585..606	CDD:275368	7/20 (35%)
		C2H2 Zn finger	614..640	CDD:275368	10/25 (40%)
		C2H2 Zn finger	642..663	CDD:275368	48/146 (33%)
		C2H2 Zn finger	671..720	CDD:275368
		C2H2 Zn finger	728..748	CDD:275368
		zf-H2C2_2	740..764	CDD:290200
		C2H2 Zn finger	756..777	CDD:275368
		C2H2 Zn finger	785..805	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910