DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10348 and ZFY

DIOPT Version :9

Sequence 1:	NP_001286059.1	Gene:	CG10348 / 35132	FlyBaseID:	FBgn0032707	Length:	540	Species:	Drosophila melanogaster
Sequence 2:	NP_001356631.1	Gene:	ZFY / 7544	HGNCID:	12870	Length:	801	Species:	Homo sapiens

Alignment Length:	108	Identity:	40/108 - (37%)
Similarity:	58/108 - (53%)	Gaps:	14/108 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly   302 NLPQRNKDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKER 366
            |.|      :.|..|||.|...:.|.:|:|.||||:||:|:|||...:.||||:.|::..|:||.
Human   541 NFP------HICVECGKGFRHPSELRKHMRIHTGEKPYQCQYCEYRSADSSNLKTHIKTKHSKEM 599

  Fly   367 PFKCEICERCFGQQTNLDRHLKKHESDAVSLSALSGVSERMHC 409
            ||||:||...|.....:.:|...|:.        |...:.:||
Human   600 PFKCDICLLTFSDTKEVQQHTLVHQE--------SKTHQCLHC 634

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10348	NP_001286059.1	COG5048	300..>363	CDD:227381	25/60 (42%)
		zf-C2H2	311..333	CDD:278523	8/21 (38%)
		C2H2 Zn finger	313..333	CDD:275368	8/19 (42%)
		zf-H2C2_2	325..349	CDD:290200	13/23 (57%)
		C2H2 Zn finger	341..362	CDD:275368	9/20 (45%)
		zf-H2C2_2	353..377	CDD:290200	12/23 (52%)
		zf-C2H2	368..390	CDD:278523	7/21 (33%)
		C2H2 Zn finger	370..390	CDD:275368	5/19 (26%)
ZFY	NP_001356631.1	Zfx_Zfy_act	71..406	CDD:309717
		COG5048	<417..592	CDD:227381	25/56 (45%)
		C2H2 Zn finger	423..443	CDD:275368
		C2H2 Zn finger	454..478	CDD:275368
		C2H2 Zn finger	486..506	CDD:275368
		COG5048	539..>676	CDD:227381	40/108 (37%)
		C2H2 Zn finger	546..566	CDD:275368	8/19 (42%)
		zf-H2C2_2	558..582	CDD:338759	13/23 (57%)
		C2H2 Zn finger	574..593	CDD:275368	9/18 (50%)
		C2H2 Zn finger	603..652	CDD:275368	9/40 (23%)
		C2H2 Zn finger	660..680	CDD:275368
		zf-C2H2	715..737	CDD:333835
		C2H2 Zn finger	717..737	CDD:275368
		zf-H2C2_2	729..753	CDD:338759
		C2H2 Zn finger	745..766	CDD:275368
		C2H2 Zn finger	774..794	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910