DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and Zfp157

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_006504688.1 Gene:Zfp157 / 72154 MGIID:1919404 Length:582 Species:Mus musculus


Alignment Length:182 Identity:53/182 - (29%)
Similarity:76/182 - (41%) Gaps:35/182 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 YTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICER 375
            |.||.|||.|...:|||||.||||.|:||:||.|.:.||..|.|..|.|. |..|:|::||.|.:
Mouse   282 YVCKDCGKAFFYKSNLTRHHRTHTREKPYECKECRKGFSSKSELTSHHRT-HTGEKPYQCEECGK 345

  Fly   376 CFGQQTNLDRHLKKHESDAVSLSALSGVSERMHCIRRFCENPTEESYFEEIRSFMGKVTQQQQQQ 440
            .|..::.|..|.|.|          ||            |.|.|....::...:...:|:.|:..
Mouse   346 AFYCKSTLRVHQKIH----------SG------------EKPYECKECQKSFYYKSTLTEHQRTH 388

  Fly   441 QQQQQHD------------QQQQQHQSTATSASSSCSSSRDTPTSSHEEADH 480
            ..::.::            |..:.|:.........|...|...:|..|...|
Mouse   389 TGEKPYECKDCGKAFFYKSQLTRHHRIHTGEKPYECEECRKAFSSKSELTAH 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 28/51 (55%)
zf-C2H2 311..333 CDD:278523 13/21 (62%)
C2H2 Zn finger 313..333 CDD:275368 12/19 (63%)
zf-H2C2_2 325..349 CDD:290200 15/23 (65%)
C2H2 Zn finger 341..362 CDD:275368 9/20 (45%)
zf-H2C2_2 353..377 CDD:290200 9/23 (39%)
zf-C2H2 368..390 CDD:278523 7/21 (33%)
C2H2 Zn finger 370..390 CDD:275368 7/19 (37%)
Zfp157XP_006504688.1 KRAB 19..79 CDD:214630
C2H2 Zn finger 173..192 CDD:275368
COG5048 196..550 CDD:227381 53/182 (29%)
C2H2 Zn finger 200..220 CDD:275368
C2H2 Zn finger 228..248 CDD:275368
C2H2 Zn finger 256..276 CDD:275368
C2H2 Zn finger 284..304 CDD:275368 12/19 (63%)
C2H2 Zn finger 312..332 CDD:275368 9/20 (45%)
C2H2 Zn finger 340..360 CDD:275368 7/19 (37%)
C2H2 Zn finger 368..388 CDD:275368 2/19 (11%)
C2H2 Zn finger 396..416 CDD:275368 2/19 (11%)
C2H2 Zn finger 424..444 CDD:275368 5/17 (29%)
C2H2 Zn finger 452..472 CDD:275368
C2H2 Zn finger 480..500 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.