DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and SP3

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_003102.1 Gene:SP3 / 6670 HGNCID:11208 Length:781 Species:Homo sapiens


Alignment Length:426 Identity:100/426 - (23%)
Similarity:157/426 - (36%) Gaps:111/426 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IPTSYISHVPYDLASSASVAATSSSST-----------------SP-----------TTTSATTT 63
            :|||..|.:|..:.|:..:...::|.|                 ||           .:|:....
Human   331 VPTSSSSQLPVTIDSTGILQQNTNSLTTSSGQVHSSDLQGNYIQSPVSEETQAQNIQVSTAQPVV 395

  Fly    64 GRLQHQHSHQ---QHQTLN-------HHAKGKRRSSFDQPL-DLRLAHKRKTDLVDQGPMEDENS 117
            ..||.|.|.|   |.|.:.       |..:...::...|.| :|:|.....|.|:....:..  |
Human   396 QHLQLQESQQPTSQAQIVQGITPQTIHGVQASGQNISQQALQNLQLQLNPGTFLIQAQTVTP--S 458

  Fly   118 NLIMFASELAVAQQKEKELNNNHIAASLADLGFDMSRKMLRALREGGAGGGGGGGGGGGGGGGPP 182
            ..:.:.:......|..:.|...:.||.      .::...::.|..|....||             
Human   459 GQVTWQTFQVQGVQNLQNLQIQNTAAQ------QITLTPVQTLTLGQVAAGG------------- 504

  Fly   183 NAPPLTPPQCSIPAVHPTLLEAMTKNLP-LQYRNVFAGVLPGKVNSPAASSSP-TGADFPFRHPL 245
                         |...|.:...|..|| ||      .|....::|......| ..||.|....:
Human   505 -------------AFTSTPVSLSTGQLPNLQ------TVTVNSIDSAGIQLHPGENADSPADIRI 550

  Fly   246 KKCELTWPPPTEQLQL---------ELPHPNPKLSPVLPHPQLQDYQTRRKNKARTAAT------ 295
            |:.|    |..|:.||         :|.|...:   |:.....|.:| ..|...|.|.|      
Human   551 KEEE----PDPEEWQLSGDSTLNTNDLTHLRVQ---VVDEEGDQQHQ-EGKRLRRVACTCPNCKE 607

  Fly   296 GGNATPNLPQRNKDRYTCKF--CGKVFPRSANLTRHLRTHTGEQPYKCK--YCERSFSISSNLQR 356
            ||....||.:  |.::.|..  ||||:.::::|..|||.|:||:|:.|.  ||.:.|:.|..|||
Human   608 GGGRGTNLGK--KKQHICHIPGCGKVYGKTSHLRAHLRWHSGERPFVCNWMYCGKRFTRSDELQR 670

  Fly   357 HVRNIHNKERPFKCEICERCFGQQTNLDRHLKKHES 392
            | |..|..|:.|.|..|.:.|.:..:|.:|:|.|::
Human   671 H-RRTHTGEKKFVCPECSKRFMRSDHLAKHIKTHQN 705

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 26/66 (39%)
zf-C2H2 311..333 CDD:278523 9/23 (39%)
C2H2 Zn finger 313..333 CDD:275368 9/21 (43%)
zf-H2C2_2 325..349 CDD:290200 11/25 (44%)
C2H2 Zn finger 341..362 CDD:275368 10/22 (45%)
zf-H2C2_2 353..377 CDD:290200 10/23 (43%)
zf-C2H2 368..390 CDD:278523 7/21 (33%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
SP3NP_003102.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..88
Transactivation domain (Gln-rich) 138..237
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 301..338 3/6 (50%)
Transactivation domain (Gln-rich) 350..499 25/156 (16%)
9aaTAD. /evidence=ECO:0000269|PubMed:31375868 461..469 0/7 (0%)
Repressor domain 534..620 24/95 (25%)
C2H2 Zn finger 623..645 CDD:275368 9/21 (43%)
COG5048 <636..718 CDD:227381 28/71 (39%)
zf-H2C2_2 637..664 CDD:290200 12/26 (46%)
C2H2 Zn finger 653..675 CDD:275368 10/22 (45%)
zf-H2C2_2 667..690 CDD:290200 10/23 (43%)
zf-C2H2 681..703 CDD:278523 7/21 (33%)
C2H2 Zn finger 683..703 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.