DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and plagx

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001034918.1 Gene:plagx / 664689 ZFINID:ZDB-GENE-030131-839 Length:380 Species:Danio rerio


Alignment Length:339 Identity:79/339 - (23%)
Similarity:119/339 - (35%) Gaps:117/339 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 YQTRRKNKARTAATGGNATPNLPQRNKDRYTCKFCGKVFPRSANLTRHLRTHTGEQP-------- 338
            |.||...:...|....:|:.:|        |||.|.:||.....|..||.||||..|        
Zfish    31 YNTRLGLRRHVATHATSASSDL--------TCKVCRQVFESMPALLEHLSTHTGRPPPGTVVRER 87

  Fly   339 -YKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKKHESDAVSLSAL-- 400
             ::|:.|.|.|....:::||. .:|...|.|.|..|.:.||::.:|.|||||  |.|..|.||  
Zfish    88 KHQCERCGRRFFTRKDVRRHA-VVHTGRRDFLCPRCAQRFGRRDHLTRHLKK--SHAQELDALPT 149

  Fly   401 ---------------------------------------SGVSERMHCIRRFCENPTEESYFEEI 426
                                                   ||||...|   .....|        :
Zfish   150 LPIKEEPSPTMCSVGSPKDVTEAFPMAMFNSQGLQSASTSGVSHHHH---GMVSGP--------L 203

  Fly   427 RSFMGKVTQQQQQQQQQQQHDQQQQQHQSTATS---------------------ASSSCSSSRD- 469
            .|.:|.....:..:...||:.|..:...|:.||                     |:.:.:.||. 
Zfish   204 SSPVGMGCYLEPNKPPPQQYQQTPRYQPSSTTSYLKAEMENFLTELQCGPMPPQAAVATAVSRPG 268

  Fly   470 --TPTSSHEEADHAPATSTADTAA--PSSSRDQEEEDSQPIMELKRTL----------TSKLFPT 520
              .|.|...::.|....::|.|:|  |:||.:         |:|...|          ::.|..:
Zfish   269 DLLPESLGGQSAHFTLRNSAFTSAEPPASSAN---------MDLSHLLGFLPFGLPPYSTPLGYS 324

  Fly   521 TTADSAMTTPQTTS 534
            ||:.:...:|..||
Zfish   325 TTSAAPAVSPSPTS 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 21/71 (30%)
zf-C2H2 311..333 CDD:278523 9/21 (43%)
C2H2 Zn finger 313..333 CDD:275368 8/19 (42%)
zf-H2C2_2 325..349 CDD:290200 11/32 (34%)
C2H2 Zn finger 341..362 CDD:275368 6/20 (30%)
zf-H2C2_2 353..377 CDD:290200 7/23 (30%)
zf-C2H2 368..390 CDD:278523 10/21 (48%)
C2H2 Zn finger 370..390 CDD:275368 9/19 (47%)
plagxNP_001034918.1 C2H2 Zn finger 54..74 CDD:275368 8/19 (42%)
C2H2 Zn finger 91..111 CDD:275368 6/20 (30%)
C2H2 Zn finger 119..137 CDD:275368 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.