| Sequence 1: | NP_001286059.1 | Gene: | CG10348 / 35132 | FlyBaseID: | FBgn0032707 | Length: | 540 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_652712.2 | Gene: | CG18764 / 59239 | FlyBaseID: | FBgn0042205 | Length: | 409 | Species: | Drosophila melanogaster |
| Alignment Length: | 202 | Identity: | 59/202 - (29%) |
|---|---|---|---|
| Similarity: | 81/202 - (40%) | Gaps: | 31/202 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 221 LPGKVNSPAASSSPTGADFPFRHPLKKCELTWPPPTEQLQLELPHPNPKLSPVLPH--PQLQDYQ 283
Fly 284 TRRKNKARTAATGGNATPNLPQRNKDRYT-------------------CKFCGKVFPRSANLTRH 329
Fly 330 LRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHL--KKHES 392
Fly 393 DAVSLSA 399 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10348 | NP_001286059.1 | COG5048 | 300..>363 | CDD:227381 | 24/81 (30%) |
| zf-C2H2 | 311..333 | CDD:278523 | 10/40 (25%) | ||
| C2H2 Zn finger | 313..333 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 325..349 | CDD:290200 | 9/23 (39%) | ||
| C2H2 Zn finger | 341..362 | CDD:275368 | 6/20 (30%) | ||
| zf-H2C2_2 | 353..377 | CDD:290200 | 9/23 (39%) | ||
| zf-C2H2 | 368..390 | CDD:278523 | 10/23 (43%) | ||
| C2H2 Zn finger | 370..390 | CDD:275368 | 9/21 (43%) | ||
| CG18764 | NP_652712.2 | zf-AD | 4..75 | CDD:214871 | |
| C2H2 Zn finger | 260..280 | CDD:275368 | 2/19 (11%) | ||
| zf-H2C2_2 | 272..297 | CDD:290200 | 5/27 (19%) | ||
| C2H2 Zn finger | 288..309 | CDD:275368 | 4/20 (20%) | ||
| C2H2 Zn finger | 317..337 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 345..365 | CDD:275368 | 6/20 (30%) | ||
| C2H2 Zn finger | 373..391 | CDD:275368 | 7/17 (41%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||