DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and Klf6

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_113830.2 Gene:Klf6 / 58954 RGDID:62389 Length:317 Species:Rattus norvegicus


Alignment Length:184 Identity:59/184 - (32%)
Similarity:86/184 - (46%) Gaps:41/184 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 SPAA--SSSPTGADFPFRHPLKKCELTWPPPTEQLQLELPHPNPKLSPV-------LPHPQLQDY 282
            ||..  :|.|.|........|....::.||.:       |..|.:.|.:       ||.|     
  Rat   154 SPTTKFTSDPIGEVLVNSGNLSSSVISTPPSS-------PEVNRESSQLWGCGPGDLPSP----- 206

  Fly   283 QTRRKNKARTAATG-------GNATPNLPQRNKDRYTCKF--CGKVFPRSANLTRHLRTHTGEQP 338
                 .|.|:..:|       |:|:|:..:|   .:.|.|  |.||:.:|::|..|.||||||:|
  Rat   207 -----GKVRSGTSGKSGDKGSGDASPDGRRR---VHRCHFNGCRKVYTKSSHLKAHQRTHTGEKP 263

  Fly   339 YKCKY--CERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKKH 390
            |:|.:  ||..|:.|..|.||.|. |...:||||..|:|||.:..:|..|:|:|
  Rat   264 YRCSWEGCEWRFARSDELTRHFRK-HTGAKPFKCSHCDRCFSRSDHLALHMKRH 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 27/66 (41%)
zf-C2H2 311..333 CDD:278523 9/23 (39%)
C2H2 Zn finger 313..333 CDD:275368 9/21 (43%)
zf-H2C2_2 325..349 CDD:290200 13/25 (52%)
C2H2 Zn finger 341..362 CDD:275368 9/22 (41%)
zf-H2C2_2 353..377 CDD:290200 11/23 (48%)
zf-C2H2 368..390 CDD:278523 10/21 (48%)
C2H2 Zn finger 370..390 CDD:275368 8/19 (42%)
Klf6NP_113830.2 COG5048 211..>299 CDD:227381 35/91 (38%)
zf-C2H2 234..258 CDD:278523 9/23 (39%)
C2H2 Zn finger 239..258 CDD:275368 7/18 (39%)
zf-H2C2_2 250..>266 CDD:290200 10/15 (67%)
C2H2 Zn finger 266..288 CDD:275368 9/22 (41%)
zf-H2C2_2 280..305 CDD:290200 13/25 (52%)
C2H2 Zn finger 296..316 CDD:275368 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.