| Sequence 1: | NP_001286059.1 | Gene: | CG10348 / 35132 | FlyBaseID: | FBgn0032707 | Length: | 540 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001275571.1 | Gene: | ZNF286A / 57335 | HGNCID: | 13501 | Length: | 564 | Species: | Homo sapiens |
| Alignment Length: | 286 | Identity: | 73/286 - (25%) |
|---|---|---|---|
| Similarity: | 112/286 - (39%) | Gaps: | 65/286 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 211 LQYRNVFAGVLPGKVNSPAASSSPTGADFPFRHPLKK--------------CELTWPPPTEQLQL 261
Fly 262 ELPHPNPKLSPVLPHPQLQDYQTRRKNKARTAATGGNATPNLPQR-----NKDRYTCKFCGKVFP 321
Fly 322 RSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRH 386
Fly 387 LKKHESDAVSLSALSGVSERMHCIRRFCENPTEESYFEEIRSFMGKVTQQQQQQQQQQQHDQQQQ 451
Fly 452 QHQSTAT----------SASSSCSSS 467 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10348 | NP_001286059.1 | COG5048 | 300..>363 | CDD:227381 | 27/67 (40%) |
| zf-C2H2 | 311..333 | CDD:278523 | 9/21 (43%) | ||
| C2H2 Zn finger | 313..333 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 325..349 | CDD:290200 | 13/23 (57%) | ||
| C2H2 Zn finger | 341..362 | CDD:275368 | 8/20 (40%) | ||
| zf-H2C2_2 | 353..377 | CDD:290200 | 8/23 (35%) | ||
| zf-C2H2 | 368..390 | CDD:278523 | 7/21 (33%) | ||
| C2H2 Zn finger | 370..390 | CDD:275368 | 7/19 (37%) | ||
| ZNF286A | NP_001275571.1 | KRAB | 88..141 | CDD:214630 | |
| KRAB | 88..123 | CDD:279668 | |||
| COG5048 | <265..400 | CDD:227381 | 21/121 (17%) | ||
| C2H2 Zn finger | 288..308 | CDD:275368 | 0/5 (0%) | ||
| zf-H2C2_2 | 301..325 | CDD:290200 | 6/29 (21%) | ||
| C2H2 Zn finger | 316..336 | CDD:275368 | 6/26 (23%) | ||
| C2H2 Zn finger | 343..363 | CDD:275368 | 6/36 (17%) | ||
| zf-H2C2_2 | 355..380 | CDD:290200 | 3/26 (12%) | ||
| C2H2 Zn finger | 371..391 | CDD:275368 | 4/19 (21%) | ||
| zf-H2C2_2 | 383..406 | CDD:290200 | 6/22 (27%) | ||
| COG5048 | <395..550 | CDD:227381 | 50/166 (30%) | ||
| zf-C2H2 | 397..419 | CDD:278523 | 9/21 (43%) | ||
| C2H2 Zn finger | 399..419 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 411..436 | CDD:290200 | 14/24 (58%) | ||
| C2H2 Zn finger | 427..447 | CDD:275368 | 8/20 (40%) | ||
| zf-H2C2_2 | 439..464 | CDD:290200 | 9/25 (36%) | ||
| C2H2 Zn finger | 455..475 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 467..492 | CDD:290200 | 6/32 (19%) | ||
| C2H2 Zn finger | 483..503 | CDD:275368 | 3/22 (14%) | ||
| zf-H2C2_2 | 495..518 | CDD:290200 | 3/22 (14%) | ||
| C2H2 Zn finger | 511..531 | CDD:275368 | 4/19 (21%) | ||
| zf-H2C2_2 | 523..548 | CDD:290200 | 6/24 (25%) | ||
| C2H2 Zn finger | 539..559 | CDD:275368 | 5/13 (38%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||