DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10348 and ZNF695

DIOPT Version :9

Sequence 1:	NP_001286059.1	Gene:	CG10348 / 35132	FlyBaseID:	FBgn0032707	Length:	540	Species:	Drosophila melanogaster
Sequence 2:	NP_065127.5	Gene:	ZNF695 / 57116	HGNCID:	30954	Length:	515	Species:	Homo sapiens

Alignment Length:	108	Identity:	44/108 - (40%)
Similarity:	60/108 - (55%)	Gaps:	11/108 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly   311 YTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICER 375
            |.|:.|||.|...:.||:|.|.||||:||||..|.::|:..|.|..|.| ||..|:|:|||.|.:
Human   408 YKCEECGKAFTWFSYLTQHKRIHTGEKPYKCDECGKAFNWFSYLTNHKR-IHTGEKPYKCEECGK 471

  Fly   376 CFGQQTNLDRHLKKHESD----------AVSLSALSGVSERMH 408
            .|||.::|.:|...|..:          |.:.||...|.|:.|
Human   472 AFGQSSHLSKHKTIHTREKPYKCEECGKAFNHSAQLAVHEKTH 514

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10348	NP_001286059.1	COG5048	300..>363	CDD:227381	25/51 (49%)
		zf-C2H2	311..333	CDD:278523	10/21 (48%)
		C2H2 Zn finger	313..333	CDD:275368	9/19 (47%)
		zf-H2C2_2	325..349	CDD:290200	13/23 (57%)
		C2H2 Zn finger	341..362	CDD:275368	7/20 (35%)
		zf-H2C2_2	353..377	CDD:290200	11/23 (48%)
		zf-C2H2	368..390	CDD:278523	9/21 (43%)
		C2H2 Zn finger	370..390	CDD:275368	8/19 (42%)
ZNF695	NP_065127.5	KRAB	4..76	CDD:214630
		COG5048	148..515	CDD:227381	44/108 (41%)
		C2H2 Zn finger	158..178	CDD:275368
		C2H2 Zn finger	186..206	CDD:275368
		C2H2 Zn finger	214..234	CDD:275368
		C2H2 Zn finger	242..262	CDD:275368
		C2H2 Zn finger	270..290	CDD:275368
		C2H2 Zn finger	298..318	CDD:275368
		C2H2 Zn finger	326..346	CDD:275368
		C2H2 Zn finger	354..374	CDD:275368
		C2H2 Zn finger	382..402	CDD:275368
		C2H2 Zn finger	410..430	CDD:275368	9/19 (47%)
		C2H2 Zn finger	438..458	CDD:275368	7/20 (35%)
		C2H2 Zn finger	466..486	CDD:275368	8/19 (42%)
		C2H2 Zn finger	494..514	CDD:275368	5/19 (26%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910