| Sequence 1: | NP_001286059.1 | Gene: | CG10348 / 35132 | FlyBaseID: | FBgn0032707 | Length: | 540 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_005162323.1 | Gene: | ikzf4 / 566844 | ZFINID: | ZDB-GENE-180319-1 | Length: | 572 | Species: | Danio rerio |
| Alignment Length: | 197 | Identity: | 51/197 - (25%) |
|---|---|---|---|
| Similarity: | 86/197 - (43%) | Gaps: | 23/197 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 294 ATGGNATPNLPQRNKDRYTCKFCGKVFPRSANLTRHLRTHT-----GEQPYKCKYCERSFSISSN 353
Fly 354 LQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKKHESDAVSLSALSGVSERMHCIRRFCENPT 418
Fly 419 EESYFEEIRSFMGKVTQQQQQQQQ----QQQHDQQQQQH---QSTATS-------ASSSCSSSRD 469
Fly 470 TP 471 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10348 | NP_001286059.1 | COG5048 | 300..>363 | CDD:227381 | 20/67 (30%) |
| zf-C2H2 | 311..333 | CDD:278523 | 6/21 (29%) | ||
| C2H2 Zn finger | 313..333 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 325..349 | CDD:290200 | 11/28 (39%) | ||
| C2H2 Zn finger | 341..362 | CDD:275368 | 8/20 (40%) | ||
| zf-H2C2_2 | 353..377 | CDD:290200 | 11/23 (48%) | ||
| zf-C2H2 | 368..390 | CDD:278523 | 7/21 (33%) | ||
| C2H2 Zn finger | 370..390 | CDD:275368 | 5/19 (26%) | ||
| ikzf4 | XP_005162323.1 | C2H2 Zn finger | 130..150 | CDD:275368 | 6/19 (32%) |
| zf-H2C2_2 | 143..172 | CDD:290200 | 12/28 (43%) | ||
| COG5048 | <146..337 | CDD:227381 | 44/162 (27%) | ||
| zf-C2H2 | 161..183 | CDD:278523 | 8/22 (36%) | ||
| C2H2 Zn finger | 163..183 | CDD:275368 | 8/20 (40%) | ||
| zf-H2C2_2 | 175..200 | CDD:290200 | 11/25 (44%) | ||
| C2H2 Zn finger | 191..211 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 224..245 | CDD:275368 | 5/20 (25%) | ||
| C2H2 Zn finger | 519..539 | CDD:275368 | |||
| C2H2 Zn finger | 547..564 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||