DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and AgaP_AGAP011407

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_001689066.1 Gene:AgaP_AGAP011407 / 5667959 VectorBaseID:AGAP011407 Length:257 Species:Anopheles gambiae


Alignment Length:332 Identity:65/332 - (19%)
Similarity:102/332 - (30%) Gaps:119/332 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 HQ------TLNHHAKGKRRSSFDQPLDLRLAHKR-KTDLVDQGPMEDENSNLIMFASELAVAQQK 132
            ||      |..:|...|.....| ||::::...| :|:|.|:....:.|.|.....|...:|.:.
Mosquito    25 HQLCVGPSTSENHGLAKNTQDVD-PLEVQIEVLRVETELFDEDTFVNGNQNTSTVPSHQEIATKN 88

  Fly   133 EKELNNNHIAASLADLGFDMSRKMLRALREGGAGGGGGGGGGGGGGGGPPNAPPLTPPQCSIPAV 197
            ..:.:.|.||.                                       |.|         ||.
Mosquito    89 NDQYSANCIAI---------------------------------------NEP---------PAE 105

  Fly   198 HPTLLEAMTKNLPLQYRNVFAGVLPGKVNSPAASSSPTGADFPFRHPLKKCELTW----PPPT-- 256
            ..|:.:|                      ..:...:|...||           ||    ..|.  
Mosquito   106 RLTVRQA----------------------PDSEKETPNDDDF-----------TWHESETDPARD 137

  Fly   257 -EQLQLELPHPNPKLSPVLPHPQLQDYQTRR--KNKARTAATGGNATPNLPQRNKDRYTCKFCGK 318
             :|..:....||.|.:..       :..|||  ..:|::::|||.:.         |..|..||.
Mosquito   138 GKQKLVRKKRPNRKRAGA-------EQITRRDPAREAKSSSTGGRSA---------RVLCSICGT 186

  Fly   319 VFPRSANLTRHLRTHTGEQPYK--CKYCERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQT 381
            ..   :||..|...|..:...|  |.:|....:...||.||:..:|.|.....||||.:.|....
Mosquito   187 FV---SNLNFHQNYHHAKTSIKLSCPHCPAKITHQKNLTRHINTVHLKIVEKTCEICGKEFTTNN 248

  Fly   382 NLDRHLK 388
            :...|::
Mosquito   249 SYVSHMR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 15/64 (23%)
zf-C2H2 311..333 CDD:278523 6/21 (29%)
C2H2 Zn finger 313..333 CDD:275368 6/19 (32%)
zf-H2C2_2 325..349 CDD:290200 7/25 (28%)
C2H2 Zn finger 341..362 CDD:275368 6/20 (30%)
zf-H2C2_2 353..377 CDD:290200 10/23 (43%)
zf-C2H2 368..390 CDD:278523 6/21 (29%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
AgaP_AGAP011407XP_001689066.1 C2H2 Zn finger 181..198 CDD:275368 6/19 (32%)
C2H2 Zn finger 208..229 CDD:275368 6/20 (30%)
C2H2 Zn finger 237..256 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.