DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and zgc:173720

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001107078.1 Gene:zgc:173720 / 566529 ZFINID:ZDB-GENE-080218-21 Length:320 Species:Danio rerio


Alignment Length:120 Identity:44/120 - (36%)
Similarity:69/120 - (57%) Gaps:13/120 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 YTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICER 375
            :||..|||.|.:|:|..:|:|.||||:|:.|..|.:|:|.||:|.:|:| ||..|:||.|..|.:
Zfish   205 FTCPQCGKSFSKSSNFNQHMRIHTGEKPFTCTQCGKSYSQSSHLNKHIR-IHTGEKPFTCTQCGK 268

  Fly   376 CFGQQTNLDRHLKKHESD--------AVSLSALSGVSERMHCIRRFCENPTEESY 422
            ||...:||::|::.|..:        ..|.|.|:.::..|    :|.....|.:|
Zfish   269 CFTCISNLNQHMRIHTGEKPFICTQCGKSFSQLTSLNYHM----KFHAGEIEFTY 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 25/51 (49%)
zf-C2H2 311..333 CDD:278523 10/21 (48%)
C2H2 Zn finger 313..333 CDD:275368 9/19 (47%)
zf-H2C2_2 325..349 CDD:290200 11/23 (48%)
C2H2 Zn finger 341..362 CDD:275368 9/20 (45%)
zf-H2C2_2 353..377 CDD:290200 10/23 (43%)
zf-C2H2 368..390 CDD:278523 8/21 (38%)
C2H2 Zn finger 370..390 CDD:275368 7/19 (37%)
zgc:173720NP_001107078.1 C2H2 Zn finger 67..87 CDD:275368
zf-H2C2_2 79..104 CDD:290200
C2H2 Zn finger 95..115 CDD:275368
zf-C2H2 121..143 CDD:278523
C2H2 Zn finger 123..143 CDD:275368
zf-H2C2_2 135..160 CDD:290200
COG5048 <147..307 CDD:227381 40/102 (39%)
C2H2 Zn finger 151..171 CDD:275368
zf-H2C2_2 163..188 CDD:290200
C2H2 Zn finger 179..199 CDD:275368
zf-H2C2_2 192..215 CDD:290200 5/9 (56%)
C2H2 Zn finger 207..227 CDD:275368 9/19 (47%)
zf-H2C2_2 219..244 CDD:290200 11/24 (46%)
C2H2 Zn finger 235..255 CDD:275368 9/20 (45%)
zf-H2C2_2 247..272 CDD:290200 12/25 (48%)
C2H2 Zn finger 263..283 CDD:275368 7/19 (37%)
zf-H2C2_2 275..300 CDD:290200 5/24 (21%)
C2H2 Zn finger 291..311 CDD:275368 4/23 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.