DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and znf1117

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001314925.1 Gene:znf1117 / 565962 ZFINID:ZDB-GENE-110914-52 Length:293 Species:Danio rerio


Alignment Length:113 Identity:48/113 - (42%)
Similarity:69/113 - (61%) Gaps:9/113 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 LPQRNKDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERP 367
            |.:|:::|:||..|||.|.|..:|..|:|.||||:||.|..|.:||||||||.:|:| ||..|:|
Zfish    58 LKKRDENRFTCTQCGKNFGRKGDLKIHMRIHTGEKPYICTQCGKSFSISSNLNQHMR-IHTGEKP 121

  Fly   368 FKCEICERCFGQQTNLDRHLKKHESD--------AVSLSALSGVSERM 407
            |.|..|.:.|.|.::|:.|:..|..:        ..|.|.||.:::.|
Zfish   122 FTCTQCGKSFSQSSHLNYHMMIHAGEKPSTCSQCGKSFSCLSHLNKHM 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 32/59 (54%)
zf-C2H2 311..333 CDD:278523 10/21 (48%)
C2H2 Zn finger 313..333 CDD:275368 9/19 (47%)
zf-H2C2_2 325..349 CDD:290200 12/23 (52%)
C2H2 Zn finger 341..362 CDD:275368 12/20 (60%)
zf-H2C2_2 353..377 CDD:290200 11/23 (48%)
zf-C2H2 368..390 CDD:278523 7/21 (33%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
znf1117NP_001314925.1 C2H2 Zn finger 68..88 CDD:275368 9/19 (47%)
zf-H2C2_2 80..104 CDD:290200 12/23 (52%)
C2H2 Zn finger 96..116 CDD:275368 12/20 (60%)
COG5048 <106..292 CDD:227381 23/65 (35%)
zf-H2C2_2 108..133 CDD:290200 12/25 (48%)
C2H2 Zn finger 124..144 CDD:275368 6/19 (32%)
C2H2 Zn finger 152..172 CDD:275368 5/18 (28%)
zf-H2C2_2 164..189 CDD:290200 1/6 (17%)
C2H2 Zn finger 180..200 CDD:275368
zf-H2C2_2 193..217 CDD:290200
C2H2 Zn finger 208..228 CDD:275368
zf-H2C2_2 220..245 CDD:290200
C2H2 Zn finger 236..256 CDD:275368
zf-H2C2_2 248..273 CDD:290200
C2H2 Zn finger 264..284 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.