DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and prdm14

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_005162704.1 Gene:prdm14 / 563151 ZFINID:ZDB-GENE-030131-2709 Length:568 Species:Danio rerio


Alignment Length:180 Identity:52/180 - (28%)
Similarity:83/180 - (46%) Gaps:38/180 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 YTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICER 375
            :.|..|||.|.:|::|.:|:|.|:||:||||.||.::|:.||.|:.|:|. |:.||||||:.|.:
Zfish   409 HKCSVCGKSFSQSSSLNKHMRVHSGERPYKCVYCNKAFTASSILRTHIRQ-HSGERPFKCKHCGK 472

  Fly   376 CFGQQTNLDRHLKK-HESDAVSLSALSGVSERMHCIRRFCENPTEESYFEEIRSFMGKVTQQQQQ 439
            .|......|.|::: |..|           :::.|                  ...|...|:.|:
Zfish   473 AFASHAAHDSHVRRTHAKD-----------KQLSC------------------DVCGATFQEAQE 508

  Fly   440 QQQQQQHDQQQQQHQSTATSASSSCSSSRDTPTSSHEEADHAPATSTADT 489
            .:      ...:.|:......||....:.:....|.:|:.|| .|..|||
Zfish   509 LK------YHMKAHKKRPLLESSVVPPADENALFSTKESLHA-QTQLADT 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 24/51 (47%)
zf-C2H2 311..333 CDD:278523 9/21 (43%)
C2H2 Zn finger 313..333 CDD:275368 9/19 (47%)
zf-H2C2_2 325..349 CDD:290200 12/23 (52%)
C2H2 Zn finger 341..362 CDD:275368 9/20 (45%)
zf-H2C2_2 353..377 CDD:290200 11/23 (48%)
zf-C2H2 368..390 CDD:278523 7/22 (32%)
C2H2 Zn finger 370..390 CDD:275368 5/20 (25%)
prdm14XP_005162704.1 SET 214..316 CDD:279228
C2H2 Zn finger 382..401 CDD:275368
zf-C2H2 409..431 CDD:278523 9/21 (43%)
C2H2 Zn finger 411..431 CDD:275368 9/19 (47%)
zf-H2C2_2 423..447 CDD:290200 12/23 (52%)
C2H2 Zn finger 439..459 CDD:275368 9/20 (45%)
zf-H2C2_2 452..476 CDD:290200 12/24 (50%)
C2H2 Zn finger 467..488 CDD:275368 5/20 (25%)
C2H2 Zn finger 496..516 CDD:275368 4/43 (9%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.