Sequence 1: | NP_001286059.1 | Gene: | CG10348 / 35132 | FlyBaseID: | FBgn0032707 | Length: | 540 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_062721.2 | Gene: | Zfp113 / 56314 | MGIID: | 1929116 | Length: | 439 | Species: | Mus musculus |
Alignment Length: | 363 | Identity: | 90/363 - (24%) |
---|---|---|---|
Similarity: | 131/363 - (36%) | Gaps: | 118/363 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 195 PAVHPTLLEAMTKNLPLQYRNVFAGVLPGKVNSPAASSSPTGADFPFRHPLKKCE---------- 249
Fly 250 ---LTWPPPTEQ---LQLELPHP-----NPKL--------------------------------S 271
Fly 272 PVLPHPQLQDYQTRRKNKARTAATGGNATPNLPQRNK-----DRYTCKFCGKVFPRSANLTRHLR 331
Fly 332 THTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKKHESD--- 393
Fly 394 -------AVSLSALSGVSERMHCIRRFCENPTEESYFEEIRSFMGKV-TQQQQQQQQQQQHDQQQ 450
Fly 451 Q-----------------QHQSTATSAS----SSCSSS 467 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10348 | NP_001286059.1 | COG5048 | 300..>363 | CDD:227381 | 31/67 (46%) |
zf-C2H2 | 311..333 | CDD:278523 | 11/21 (52%) | ||
C2H2 Zn finger | 313..333 | CDD:275368 | 10/19 (53%) | ||
zf-H2C2_2 | 325..349 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 341..362 | CDD:275368 | 10/20 (50%) | ||
zf-H2C2_2 | 353..377 | CDD:290200 | 9/23 (39%) | ||
zf-C2H2 | 368..390 | CDD:278523 | 5/21 (24%) | ||
C2H2 Zn finger | 370..390 | CDD:275368 | 5/19 (26%) | ||
Zfp113 | NP_062721.2 | zf-H2C2_2 | 243..268 | CDD:290200 | 13/24 (54%) |
C2H2 Zn finger | 259..279 | CDD:275368 | 10/20 (50%) | ||
zf-H2C2_2 | 275..295 | CDD:290200 | 8/20 (40%) | ||
C2H2 Zn finger | 287..307 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 300..324 | CDD:290200 | 4/23 (17%) | ||
C2H2 Zn finger | 315..335 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 331..352 | CDD:290200 | 7/31 (23%) | ||
C2H2 Zn finger | 343..363 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 355..380 | CDD:290200 | 3/24 (13%) | ||
C2H2 Zn finger | 371..391 | CDD:275368 | 3/19 (16%) | ||
zf-H2C2_2 | 384..408 | CDD:290200 | 6/22 (27%) | ||
C2H2 Zn finger | 399..419 | CDD:275368 | 2/7 (29%) | ||
KRAB | 52..>92 | CDD:214630 | 8/26 (31%) | ||
KRAB | 52..91 | CDD:279668 | 8/25 (32%) | ||
COG5048 | <169..415 | CDD:227381 | 66/251 (26%) | ||
C2H2 Zn finger | 179..195 | CDD:275368 | 2/15 (13%) | ||
zf-C2H2 | 201..223 | CDD:278523 | 5/21 (24%) | ||
C2H2 Zn finger | 203..223 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 215..240 | CDD:290200 | 8/24 (33%) | ||
C2H2 Zn finger | 231..251 | CDD:275368 | 10/19 (53%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |