DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and klf11a

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_021324131.1 Gene:klf11a / 560787 ZFINID:ZDB-GENE-030131-3568 Length:479 Species:Danio rerio


Alignment Length:478 Identity:110/478 - (23%)
Similarity:164/478 - (34%) Gaps:181/478 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EKDHSPRKMLPSPKQGCVYPALGLIPTSYISHVPYDLASSASVAAT--------SSSSTSPTTTS 59
            ::.|.||.:.|: ...|  .:|.|.|.  :...|.||.|.:|:..|        .:|.|:..:||
Zfish    55 QRTHKPRPLTPT-SDSC--DSLALQPE--LIESPKDLVSLSSLCMTPPHSPSFAETSGTAVLSTS 114

  Fly    60 ATTTGRLQHQH--SHQQHQTLNHHAKGKRRSSFDQPLDLRLAHKRKTDLVDQGPMEDENSNLIMF 122
            ...:|...|..  |...::...|.:                .|...|.|::..|.:......:..
Zfish   115 VACSGLKPHPRLCSALTNRAACHVS----------------LHPSTTVLLNPAPPQTAEQPSLRR 163

  Fly   123 ASELAVAQQKEKELNNNHIAASLADLGFDMSRKMLRALREGGAGGGGGGGGGGGGGGGPPNAPPL 187
            |:.               :....||...|                              .|.|..
Zfish   164 ATS---------------VIRHTADRSMD------------------------------HNIPST 183

  Fly   188 TPPQ---CS--IPAVHPTLLEAMTKNLPLQYRNVFAGVLPGKV---NSPAASSSP---------T 235
            |..|   ||  ||..|   .|:.|.             |.|:|   :||..|:.|         |
Zfish   184 TTGQEKPCSSEIPPEH---TESNTS-------------LKGEVQICSSPCDSAEPERTAPSPDST 232

  Fly   236 GADFP-FRHPLKKCELTWPP------PTE--------------QLQLE-----LPHPNPKL--SP 272
            |...| .:..:.:..::.||      |..              |:|..     |||..|.|  ||
Zfish   233 GIAIPTSQSTIPQSPMSSPPVLCQVFPVNGQTGIISAFVQTPVQMQTSGSKPILPHSQPLLVGSP 297

  Fly   273 --------VLPHPQLQDYQTRRKNKARTAATGGNATPNLP-----------------------QR 306
                    |:|..|:....|.:    ::..|.|| |..||                       :|
Zfish   298 VAQGTVMFVVPQSQVSQSSTCQ----QSVVTLGN-TKLLPLAPAPVYVPSGQSSGVTQSDFSRRR 357

  Fly   307 NKDRYTCKF--CGKVFPRSANLTRHLRTHTGEQPYKCKY--CERSFSISSNLQRHVRNIHNKERP 367
            |   |.|.|  |.|.:.:|::|..||||||||:|:.|.:  |::.|:.|..|.|| |..|..|:.
Zfish   358 N---YVCNFQGCKKTYFKSSHLKAHLRTHTGEKPFSCHWEGCDKKFARSDELSRH-RRTHTGEKK 418

  Fly   368 FKCEICERCFGQQTNLDRHLKKH 390
            |.|.:|||.|.:..:|.:|.::|
Zfish   419 FVCPVCERRFMRSDHLTKHARRH 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 29/89 (33%)
zf-C2H2 311..333 CDD:278523 10/23 (43%)
C2H2 Zn finger 313..333 CDD:275368 9/21 (43%)
zf-H2C2_2 325..349 CDD:290200 12/25 (48%)
C2H2 Zn finger 341..362 CDD:275368 8/22 (36%)
zf-H2C2_2 353..377 CDD:290200 11/23 (48%)
zf-C2H2 368..390 CDD:278523 8/21 (38%)
C2H2 Zn finger 370..390 CDD:275368 7/19 (37%)
klf11aXP_021324131.1 MotB_plug <203..345 CDD:330912 33/159 (21%)
C2H2 Zn finger 361..383 CDD:275368 9/21 (43%)
zf-H2C2_2 375..402 CDD:316026 13/26 (50%)
C2H2 Zn finger 391..413 CDD:275368 8/22 (36%)
zf-H2C2_2 405..428 CDD:316026 11/23 (48%)
zf-C2H2 419..441 CDD:306579 8/21 (38%)
C2H2 Zn finger 421..441 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.