DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and klf5b

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_688525.5 Gene:klf5b / 560043 ZFINID:ZDB-GENE-080424-4 Length:344 Species:Danio rerio


Alignment Length:239 Identity:70/239 - (29%)
Similarity:107/239 - (44%) Gaps:50/239 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 PNAP----------PLTPPQCSIPAVHPTLLEA-------MTKN---LPLQYRNVFAGVLPGKVN 226
            ||.|          ...||..:..::||.....       |..|   ||.|:     |..|.|..
Zfish   128 PNVPGGHSCTDSHNATCPPMSTYNSIHPASSHGTERSICNMASNGYSLPAQF-----GQHPQKRA 187

  Fly   227 S---PAASSSPTGADFPFRHPLKKCELTW---PPPTEQLQLELPHPNPKLSPVLPHPQLQDYQTR 285
            :   |:..:|..|:      |.::.||..   |||:....:.     .|::.:.|.|.| ..||:
Zfish   188 AYLPPSPPNSEPGS------PDRRKELIQNLSPPPSYAASMA-----SKMACLTPGPAL-SVQTQ 240

  Fly   286 RKNKARTAATGGNATPNLPQRNKDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKY--CERSF 348
            :.    .|.....:.|:|.:|.........|.||:.:|::|..||||||||:||||.:  |:..|
Zfish   241 QV----PAQYNRRSNPDLDKRRIHHCDVPGCKKVYTKSSHLKAHLRTHTGEKPYKCSWEGCDWRF 301

  Fly   349 SISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKKHES 392
            :.|..|.||.|. |...:||:|.:|.|||.:..:|..|:|:|::
Zfish   302 ARSDELTRHFRK-HTGAKPFQCSVCSRCFSRSDHLALHMKRHQN 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 27/64 (42%)
zf-C2H2 311..333 CDD:278523 8/21 (38%)
C2H2 Zn finger 313..333 CDD:275368 8/19 (42%)
zf-H2C2_2 325..349 CDD:290200 14/25 (56%)
C2H2 Zn finger 341..362 CDD:275368 8/22 (36%)
zf-H2C2_2 353..377 CDD:290200 10/23 (43%)
zf-C2H2 368..390 CDD:278523 9/21 (43%)
C2H2 Zn finger 370..390 CDD:275368 8/19 (42%)
klf5bXP_688525.5 COG5048 236..>323 CDD:227381 33/91 (36%)
C2H2 Zn finger 265..284 CDD:275368 8/18 (44%)
C2H2 Zn finger 292..314 CDD:275368 8/22 (36%)
zf-H2C2_2 306..331 CDD:290200 12/25 (48%)
C2H2 Zn finger 322..342 CDD:275368 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.