Sequence 1: | NP_001286059.1 | Gene: | CG10348 / 35132 | FlyBaseID: | FBgn0032707 | Length: | 540 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001018578.1 | Gene: | znf989 / 553777 | ZFINID: | ZDB-GENE-050522-337 | Length: | 381 | Species: | Danio rerio |
Alignment Length: | 232 | Identity: | 59/232 - (25%) |
---|---|---|---|
Similarity: | 106/232 - (45%) | Gaps: | 37/232 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 256 TEQLQLE----LPHPNPKLSPVL-----PHPQLQDYQTRRKNKARTAATGGNATP--NLPQR--N 307
Fly 308 KDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEI 372
Fly 373 CERCFGQQTNLDRHLKKHESDAVSLSALSGVSER----MHCIRRFCENPTEESYFEEIRSFMGK- 432
Fly 433 ---VTQQQQQQQQQQQHDQQQQQHQSTATSASSSCSS 466 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10348 | NP_001286059.1 | COG5048 | 300..>363 | CDD:227381 | 24/66 (36%) |
zf-C2H2 | 311..333 | CDD:278523 | 9/21 (43%) | ||
C2H2 Zn finger | 313..333 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 325..349 | CDD:290200 | 9/23 (39%) | ||
C2H2 Zn finger | 341..362 | CDD:275368 | 7/20 (35%) | ||
zf-H2C2_2 | 353..377 | CDD:290200 | 7/23 (30%) | ||
zf-C2H2 | 368..390 | CDD:278523 | 6/21 (29%) | ||
C2H2 Zn finger | 370..390 | CDD:275368 | 6/19 (32%) | ||
znf989 | NP_001018578.1 | C2H2 Zn finger | 78..98 | CDD:275368 | 8/19 (42%) |
zf-H2C2_2 | 90..115 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 106..126 | CDD:275368 | 7/20 (35%) | ||
C2H2 Zn finger | 134..154 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 146..171 | CDD:290200 | 9/36 (25%) | ||
COG5048 | <149..377 | CDD:227381 | 19/90 (21%) | ||
C2H2 Zn finger | 162..182 | CDD:275368 | 5/20 (25%) | ||
C2H2 Zn finger | 190..210 | CDD:275368 | 3/19 (16%) | ||
C2H2 Zn finger | 218..238 | CDD:275368 | 2/6 (33%) | ||
zf-H2C2_2 | 231..255 | CDD:290200 | |||
C2H2 Zn finger | 246..266 | CDD:275368 | |||
zf-H2C2_2 | 258..283 | CDD:290200 | |||
C2H2 Zn finger | 274..294 | CDD:275368 | |||
zf-H2C2_2 | 290..311 | CDD:290200 | |||
C2H2 Zn finger | 302..322 | CDD:275368 | |||
zf-H2C2_2 | 314..339 | CDD:290200 | |||
C2H2 Zn finger | 330..350 | CDD:275368 | |||
C2H2 Zn finger | 356..376 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |