| Sequence 1: | NP_001286059.1 | Gene: | CG10348 / 35132 | FlyBaseID: | FBgn0032707 | Length: | 540 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001016305.1 | Gene: | fezf2 / 549059 | XenbaseID: | XB-GENE-1006432 | Length: | 435 | Species: | Xenopus tropicalis |
| Alignment Length: | 324 | Identity: | 81/324 - (25%) |
|---|---|---|---|
| Similarity: | 117/324 - (36%) | Gaps: | 82/324 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 139 NHIAASLADLGFDMSRKMLRALREGGAGGGGGGGGGGGGGGGPPNAPPL----TPPQCSIPAVHP 199
Fly 200 TLLEAMTKNLPLQYRNVFAGVLPGKVNSPAA-SSSPTGA----DFPFRHPLKKCELTWPPPTEQL 259
Fly 260 QLELP---------------HP--------------------------------NPKLS------ 271
Fly 272 ---PVLPHPQL---QDYQTRRKNKARTAATGGNATPNLPQRNKDR----YTCKFCGKVFPRSANL 326
Fly 327 TRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKKH 390 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10348 | NP_001286059.1 | COG5048 | 300..>363 | CDD:227381 | 26/66 (39%) |
| zf-C2H2 | 311..333 | CDD:278523 | 12/21 (57%) | ||
| C2H2 Zn finger | 313..333 | CDD:275368 | 11/19 (58%) | ||
| zf-H2C2_2 | 325..349 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 341..362 | CDD:275368 | 8/20 (40%) | ||
| zf-H2C2_2 | 353..377 | CDD:290200 | 10/23 (43%) | ||
| zf-C2H2 | 368..390 | CDD:278523 | 6/21 (29%) | ||
| C2H2 Zn finger | 370..390 | CDD:275368 | 5/19 (26%) | ||
| fezf2 | NP_001016305.1 | Engrailed homology 1 repressor. /evidence=ECO:0000250 | 27..42 | 4/14 (29%) | |
| COG5048 | <239..401 | CDD:227381 | 36/95 (38%) | ||
| C2H2 Zn finger | 256..276 | CDD:275368 | 11/19 (58%) | ||
| C2H2 Zn finger | 284..304 | CDD:275368 | 8/20 (40%) | ||
| C2H2 Zn finger | 312..332 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 340..360 | CDD:275368 | |||
| C2H2 Zn finger | 368..388 | CDD:275368 | |||
| C2H2 Zn finger | 396..414 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||