DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and zgc:113294

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001013567.1 Gene:zgc:113294 / 541422 ZFINID:ZDB-GENE-050320-124 Length:332 Species:Danio rerio


Alignment Length:186 Identity:55/186 - (29%)
Similarity:91/186 - (48%) Gaps:35/186 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 FPFRH-PLKKCELTWPPPTEQLQLELPHPNPK-----LSPVLPHPQLQDY--------------- 282
            ||.:| .:::..:.:..|.||.:..:|   ||     .:.:..:.|.::|               
Zfish    17 FPVKHEEIEEFIIKYEDPEEQTEDLIP---PKEEGQDQNEMEENDQYEEYCDFTPEEDSEQTNAS 78

  Fly   283 --QTRRKNKARTAATGGNA-------TPNLPQRNKDR-YTCKFCGKVFPRSANLTRHLRTHTGEQ 337
              :|.||.|:.|....|.:       ..::...|.:: |||:.|||.|....||..|:||||.|:
Zfish    79 SEETARKAKSNTCHQCGRSFTRKQYLIEHMTIHNGEKPYTCQQCGKSFTWKQNLKIHMRTHTDEK 143

  Fly   338 PYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKKHESD 393
            ||.|..|.:||:.:.||.:|: .:|..|:|:.||.|.:||.:|.||..|::.|..:
Zfish   144 PYTCHQCGKSFARNQNLSKHM-GVHTGEKPYTCECCGKCFTRQQNLTGHMRVHTGE 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 25/63 (40%)
zf-C2H2 311..333 CDD:278523 11/21 (52%)
C2H2 Zn finger 313..333 CDD:275368 9/19 (47%)
zf-H2C2_2 325..349 CDD:290200 13/23 (57%)
C2H2 Zn finger 341..362 CDD:275368 7/20 (35%)
zf-H2C2_2 353..377 CDD:290200 9/23 (39%)
zf-C2H2 368..390 CDD:278523 9/21 (43%)
C2H2 Zn finger 370..390 CDD:275368 9/19 (47%)
zgc:113294NP_001013567.1 COG5048 <71..207 CDD:227381 44/129 (34%)
C2H2 Zn finger 91..111 CDD:275368 1/19 (5%)
zf-H2C2_2 103..127 CDD:290200 7/23 (30%)
C2H2 Zn finger 119..139 CDD:275368 9/19 (47%)
zf-H2C2_2 131..156 CDD:290200 14/24 (58%)
C2H2 Zn finger 147..167 CDD:275368 7/20 (35%)
zf-H2C2_2 159..184 CDD:290200 11/25 (44%)
C2H2 Zn finger 175..195 CDD:275368 9/19 (47%)
zf-H2C2_2 187..211 CDD:290200 4/12 (33%)
C2H2 Zn finger 203..223 CDD:275368
C2H2 Zn finger 231..251 CDD:275368
COG5048 259..>318 CDD:227381
C2H2 Zn finger 259..279 CDD:275368
zf-H2C2_2 272..296 CDD:290200
C2H2 Zn finger 287..307 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.