DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and zgc:113295

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_021326232.1 Gene:zgc:113295 / 541420 ZFINID:ZDB-GENE-050320-122 Length:366 Species:Danio rerio


Alignment Length:208 Identity:59/208 - (28%)
Similarity:90/208 - (43%) Gaps:50/208 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 YQTRRKNKARTAATG-----------GNATPNLPQRN------KDRYTCKFCGKVFPRSANLTRH 329
            ||....||..|..||           |...|:|..|:      :..:||..|||.|.::..|.:|
Zfish    95 YQLSNLNKHMTIHTGEKPYTCTHCGRGFYQPSLLNRHMRVHTGEKPFTCTQCGKSFNQATQLKQH 159

  Fly   330 LRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHL------K 388
            :..||||:|:.|..|..||:.||.|.:|:| ||..|:|:.|..|...||..::|.||:      |
Zfish   160 MMNHTGEKPFTCTQCGTSFTQSSALNKHMR-IHTGEKPYTCTQCGTSFGASSSLSRHMLIHTGEK 223

  Fly   389 KHESDAVSLSALSGVSERMHCIRRFCENP-----TEESY---------------------FEEIR 427
            .|:.|..|.:.||....::|......|.|     .|:|:                     |:.::
Zfish   224 THKCDHCSKTFLSASHLKVHLAVHRSEKPYSCPVCEKSFTLKCILKRHQKIHTGVREHLCFKCVK 288

  Fly   428 SFMGKVTQQQQQQ 440
            :||.....:|.::
Zfish   289 TFMSAAELKQHER 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 26/68 (38%)
zf-C2H2 311..333 CDD:278523 8/21 (38%)
C2H2 Zn finger 313..333 CDD:275368 7/19 (37%)
zf-H2C2_2 325..349 CDD:290200 10/23 (43%)
C2H2 Zn finger 341..362 CDD:275368 9/20 (45%)
zf-H2C2_2 353..377 CDD:290200 9/23 (39%)
zf-C2H2 368..390 CDD:278523 8/27 (30%)
C2H2 Zn finger 370..390 CDD:275368 8/25 (32%)
zgc:113295XP_021326232.1 C2H2 Zn finger 59..79 CDD:275368
COG5048 <71..355 CDD:227381 59/208 (28%)
C2H2 Zn finger 87..107 CDD:275368 5/11 (45%)
C2H2 Zn finger 115..135 CDD:275368 4/19 (21%)
C2H2 Zn finger 143..163 CDD:275368 7/19 (37%)
C2H2 Zn finger 171..191 CDD:275368 9/20 (45%)
C2H2 Zn finger 199..219 CDD:275368 7/19 (37%)
C2H2 Zn finger 227..247 CDD:275368 5/19 (26%)
C2H2 Zn finger 255..275 CDD:275368 2/19 (11%)
C2H2 Zn finger 283..303 CDD:275368 4/19 (21%)
C2H2 Zn finger 311..331 CDD:275368
C2H2 Zn finger 339..359 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.