DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and PLAGL2

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_002648.1 Gene:PLAGL2 / 5326 HGNCID:9047 Length:496 Species:Homo sapiens


Alignment Length:285 Identity:55/285 - (19%)
Similarity:115/285 - (40%) Gaps:55/285 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 VLPHPQLQDYQTRRKNKARTAAT----GGNATP-NLPQRNKDRYTCK--FCGKVFPRSANLTRHL 330
            ::|.|:.::.:::.|.:...:.|    |....| :|||..:..|:|.  .|||.|.....|.||:
Human    25 LVPRPRGREAESQVKCQCEISGTPFSNGEKLRPHSLPQPEQRPYSCPQLHCGKAFASKYKLYRHM 89

  Fly   331 RTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKKHESDAV 395
            .||:.::|::|.||::.|....:|:.|::.....:....|..|.:.:..:....|||..|.:.:.
Human    90 ATHSAQKPHQCMYCDKMFHRKDHLRNHLQTHDPNKEALHCSECGKNYNTKLGYRRHLAMHAASSG 154

  Fly   396 SLSALSGVSERMHCIRRFCENPTEESYFEEIRSFMGKVTQQQQQQQQQQQHDQQQ-------QQH 453
            .||.       ..|::.|   .:.::..|.:::...:|....::::....|..::       ::|
Human   155 DLSC-------KVCLQTF---ESTQALLEHLKAHSRRVAGGAKEKKHPCDHCDRRFYTRKDVRRH 209

  Fly   454 QSTATSAS----SSCSSSRDTPTSSHEEADHAPATSTADTAAPSSSRDQEEEDSQPIMELKRTLT 514
            ....|...    ..|:       ......||.             :|..::..||.::::|....
Human   210 LVVHTGRKDFLCQYCA-------QRFGRKDHL-------------TRHVKKSHSQELLKIKTEPV 254

  Fly   515 SKLFPTTTADSAMTTPQTTSIKEEV 539
            ..|       ..::...|.|:|||:
Human   255 DML-------GLLSCSSTVSVKEEL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 22/65 (34%)
zf-C2H2 311..333 CDD:278523 9/23 (39%)
C2H2 Zn finger 313..333 CDD:275368 8/21 (38%)
zf-H2C2_2 325..349 CDD:290200 9/23 (39%)
C2H2 Zn finger 341..362 CDD:275368 6/20 (30%)
zf-H2C2_2 353..377 CDD:290200 4/23 (17%)
zf-C2H2 368..390 CDD:278523 5/21 (24%)
C2H2 Zn finger 370..390 CDD:275368 5/19 (26%)
PLAGL2NP_002648.1 C2H2 Zn finger 70..92 CDD:275368 8/21 (38%)
zf-H2C2_2 85..109 CDD:404364 10/23 (43%)
C2H2 Zn finger 100..120 CDD:275368 6/19 (32%)
C2H2 Zn finger 129..149 CDD:275368 5/19 (26%)
C2H2 Zn finger 158..178 CDD:275368 3/29 (10%)
C2H2 Zn finger 193..213 CDD:275368 2/19 (11%)
C2H2 Zn finger 221..239 CDD:275368 4/37 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.