DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and KLF3

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_057615.3 Gene:KLF3 / 51274 HGNCID:16516 Length:345 Species:Homo sapiens


Alignment Length:346 Identity:77/346 - (22%)
Similarity:118/346 - (34%) Gaps:147/346 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 PPNAPPLTPPQCSIPAVHPTLLEAMTKNLPLQYRNVFAGVLPGK--------------------V 225
            |.....:.|...|.|:   ..:|:|..|   :|..:::..||.|                    |
Human     8 PVKQEAMDPVSVSYPS---NYMESMKPN---KYGVIYSTPLPEKFFQTPEGLSHGIQMEPVDLTV 66

  Fly   226 NS----PAASSSPTGADFPFRH--------------PLKKCELTWPPPTEQLQ-----LELP--- 264
            |.    |:|.:||:...||..|              |:||    :.||:..:|     |.:|   
Human    67 NKRSSPPSAGNSPSSLKFPSSHRRASPGLSMPSSSPPIKK----YSPPSPGVQPFGVPLSMPPVM 127

  Fly   265 ----------HPN--PKLSPVLPH-------------------------------PQLQDYQ--- 283
                      .|.  |.:.||:..                               |.::.|:   
Human   128 AAALSRHGIRSPGILPVIQPVVVQPVPFMYTSHLQQPLMVSLSEEMENSSSSMQVPVIESYEKPI 192

  Fly   284 TRRKNK-------ARTAATGGNATPNL---------------------------------PQRNK 308
            :::|.|       .||.......:|.|                                 .||.:
Human   193 SQKKIKIEPGIEPQRTDYYPEEMSPPLMNSVSPPQALLQENHPSVIVQPGKRPLPVESPDTQRKR 257

  Fly   309 DRYTCKF--CGKVFPRSANLTRHLRTHTGEQPYKCKY--CERSFSISSNLQRHVRNIHNKERPFK 369
            ..:.|.:  |.||:.:|::|..|.||||||:||||.:  |...|:.|..|.||.|. |...:||:
Human   258 RIHRCDYDGCNKVYTKSSHLKAHRRTHTGEKPYKCTWEGCTWKFARSDELTRHFRK-HTGIKPFQ 321

  Fly   370 CEICERCFGQQTNLDRHLKKH 390
            |..|:|.|.:..:|..|.|:|
Human   322 CPDCDRSFSRSDHLALHRKRH 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 28/99 (28%)
zf-C2H2 311..333 CDD:278523 8/23 (35%)
C2H2 Zn finger 313..333 CDD:275368 8/21 (38%)
zf-H2C2_2 325..349 CDD:290200 13/25 (52%)
C2H2 Zn finger 341..362 CDD:275368 8/22 (36%)
zf-H2C2_2 353..377 CDD:290200 10/23 (43%)
zf-C2H2 368..390 CDD:278523 8/21 (38%)
C2H2 Zn finger 370..390 CDD:275368 7/19 (37%)
KLF3NP_057615.3 Repressor domain 1..74 13/71 (18%)
KLF3_N 49..260 CDD:410554 31/214 (14%)
9aaTAD, inactive. /evidence=ECO:0000269|PubMed:31375868 60..68 1/7 (14%)
CTBP-binding motif 61..65 0/3 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 66..112 14/49 (29%)
zf-C2H2 260..284 CDD:395048 8/23 (35%)
C2H2 Zn finger 262..284 CDD:275368 8/21 (38%)
C2H2 Zn finger 292..314 CDD:275368 8/22 (36%)
zf-H2C2_2 306..331 CDD:404364 11/25 (44%)
C2H2 Zn finger 322..342 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.