DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and ZNF691

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001229668.1 Gene:ZNF691 / 51058 HGNCID:28028 Length:315 Species:Homo sapiens


Alignment Length:298 Identity:78/298 - (26%)
Similarity:109/298 - (36%) Gaps:77/298 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 PFRHPLKKCELTWPPPTEQLQLELPHPNPKLSPVL--PHPQLQDYQTRRKNKARTAATGGNATPN 302
            |:|  :...|.:|.||.|:     .|....||..|  .||:    :..:|...|....|......
Human    53 PWR--VDDSEGSWIPPGEK-----EHGQESLSDELQETHPK----KPWQKVTVRARELGDPIAHP 106

  Fly   303 LPQRNKDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKE-- 365
            ..:.::..:.|..|||.|..::||..|.|.||||:||||..|.:|||.|||..||.| ||.:|  
Human   107 RHEADEKPFICAQCGKTFNNTSNLRTHQRIHTGEKPYKCSECGKSFSRSSNRIRHER-IHLEEKH 170

  Fly   366 --------------------------RPFKCEICERCFGQQTNLDRHLKKHESDA---------- 394
                                      ||::|:||.:.|.|...|..|.:.|...|          
Human   171 YKCPKCQESFRRRSDLTTHQQDHLGKRPYRCDICGKSFSQSATLAVHHRTHLEPAPYICCECGKS 235

  Fly   395 VSLSALSGVSERMHCIRRFCENPTEESYFEEIRSFMGKVTQQQQQQQQQQQHDQQQQQHQSTATS 459
            .|.|:..||..|.|...|..|.......|.:|.:|                 ...|:.|:.....
Human   236 FSNSSSFGVHHRTHTGERPYECTECGRTFSDISNF-----------------GAHQRTHRGEKPY 283

  Fly   460 ASSSCSS--SRDTPTSSHEEADHAPATSTADTAAPSSS 495
            ..:.|..  ||.:....|::      |...:.|...||
Human   284 RCTVCGKHFSRSSNLIRHQK------THLGEQAGKDSS 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 28/62 (45%)
zf-C2H2 311..333 CDD:278523 9/21 (43%)
C2H2 Zn finger 313..333 CDD:275368 9/19 (47%)
zf-H2C2_2 325..349 CDD:290200 14/23 (61%)
C2H2 Zn finger 341..362 CDD:275368 11/20 (55%)
zf-H2C2_2 353..377 CDD:290200 12/51 (24%)
zf-C2H2 368..390 CDD:278523 7/21 (33%)
C2H2 Zn finger 370..390 CDD:275368 7/19 (37%)
ZNF691NP_001229668.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..90 13/47 (28%)
COG5048 <108..266 CDD:227381 50/158 (32%)
C2H2 Zn finger 117..137 CDD:275368 9/19 (47%)
C2H2 Zn finger 145..165 CDD:275368 11/20 (55%)
C2H2 Zn finger 173..193 CDD:275368 0/19 (0%)
C2H2 Zn finger 201..221 CDD:275368 7/19 (37%)
C2H2 Zn finger 229..249 CDD:275368 5/19 (26%)
C2H2 Zn finger 257..277 CDD:275368 4/36 (11%)
zf-C2H2 283..305 CDD:306579 4/27 (15%)
C2H2 Zn finger 285..305 CDD:275368 4/25 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.