| Sequence 1: | NP_001286059.1 | Gene: | CG10348 / 35132 | FlyBaseID: | FBgn0032707 | Length: | 540 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001229668.1 | Gene: | ZNF691 / 51058 | HGNCID: | 28028 | Length: | 315 | Species: | Homo sapiens |
| Alignment Length: | 298 | Identity: | 78/298 - (26%) |
|---|---|---|---|
| Similarity: | 109/298 - (36%) | Gaps: | 77/298 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 240 PFRHPLKKCELTWPPPTEQLQLELPHPNPKLSPVL--PHPQLQDYQTRRKNKARTAATGGNATPN 302
Fly 303 LPQRNKDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKE-- 365
Fly 366 --------------------------RPFKCEICERCFGQQTNLDRHLKKHESDA---------- 394
Fly 395 VSLSALSGVSERMHCIRRFCENPTEESYFEEIRSFMGKVTQQQQQQQQQQQHDQQQQQHQSTATS 459
Fly 460 ASSSCSS--SRDTPTSSHEEADHAPATSTADTAAPSSS 495 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10348 | NP_001286059.1 | COG5048 | 300..>363 | CDD:227381 | 28/62 (45%) |
| zf-C2H2 | 311..333 | CDD:278523 | 9/21 (43%) | ||
| C2H2 Zn finger | 313..333 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 325..349 | CDD:290200 | 14/23 (61%) | ||
| C2H2 Zn finger | 341..362 | CDD:275368 | 11/20 (55%) | ||
| zf-H2C2_2 | 353..377 | CDD:290200 | 12/51 (24%) | ||
| zf-C2H2 | 368..390 | CDD:278523 | 7/21 (33%) | ||
| C2H2 Zn finger | 370..390 | CDD:275368 | 7/19 (37%) | ||
| ZNF691 | NP_001229668.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..90 | 13/47 (28%) | |
| COG5048 | <108..266 | CDD:227381 | 50/158 (32%) | ||
| C2H2 Zn finger | 117..137 | CDD:275368 | 9/19 (47%) | ||
| C2H2 Zn finger | 145..165 | CDD:275368 | 11/20 (55%) | ||
| C2H2 Zn finger | 173..193 | CDD:275368 | 0/19 (0%) | ||
| C2H2 Zn finger | 201..221 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 229..249 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 257..277 | CDD:275368 | 4/36 (11%) | ||
| zf-C2H2 | 283..305 | CDD:306579 | 4/27 (15%) | ||
| C2H2 Zn finger | 285..305 | CDD:275368 | 4/25 (16%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||