Sequence 1: | NP_001286059.1 | Gene: | CG10348 / 35132 | FlyBaseID: | FBgn0032707 | Length: | 540 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001013324.1 | Gene: | zgc:113135 / 503712 | ZFINID: | ZDB-GENE-050306-7 | Length: | 323 | Species: | Danio rerio |
Alignment Length: | 270 | Identity: | 71/270 - (26%) |
---|---|---|---|
Similarity: | 104/270 - (38%) | Gaps: | 47/270 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 255 PTEQLQL-----ELPHPNPK-------LSPVLPHPQLQDYQTRRKNKARTAAT--------GGNA 299
Fly 300 TPNLPQRNKDR-YTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHN 363
Fly 364 KERPFKCEICERCFGQQTNLDRHLKKH--ESDAVSLSALSGVSERMHCIRRFCENPTEESY--FE 424
Fly 425 EIRSFMGKVTQQQQQQQQQQQHDQQQQQHQSTATS----ASSSCSSSRDTPTS--SHEEADHAPA 483
Fly 484 TSTADTAAPS 493 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10348 | NP_001286059.1 | COG5048 | 300..>363 | CDD:227381 | 29/63 (46%) |
zf-C2H2 | 311..333 | CDD:278523 | 11/21 (52%) | ||
C2H2 Zn finger | 313..333 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 325..349 | CDD:290200 | 13/23 (57%) | ||
C2H2 Zn finger | 341..362 | CDD:275368 | 8/20 (40%) | ||
zf-H2C2_2 | 353..377 | CDD:290200 | 10/23 (43%) | ||
zf-C2H2 | 368..390 | CDD:278523 | 6/21 (29%) | ||
C2H2 Zn finger | 370..390 | CDD:275368 | 6/19 (32%) | ||
zgc:113135 | NP_001013324.1 | C2H2 Zn finger | 79..95 | CDD:275368 | 3/15 (20%) |
C2H2 Zn finger | 103..123 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 115..138 | CDD:290200 | 12/22 (55%) | ||
C2H2 Zn finger | 131..151 | CDD:275368 | 8/20 (40%) | ||
COG5048 | <159..316 | CDD:227381 | 27/134 (20%) | ||
C2H2 Zn finger | 159..179 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 171..196 | CDD:290200 | 6/24 (25%) | ||
C2H2 Zn finger | 187..207 | CDD:275368 | 2/19 (11%) | ||
zf-H2C2_2 | 199..222 | CDD:290200 | 3/22 (14%) | ||
C2H2 Zn finger | 215..235 | CDD:275368 | 5/34 (15%) | ||
zf-H2C2_2 | 227..252 | CDD:290200 | 5/24 (21%) | ||
C2H2 Zn finger | 243..263 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 271..291 | CDD:275368 | 2/7 (29%) | ||
C2H2 Zn finger | 298..318 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |