DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10348 and LOC496795

DIOPT Version :9

Sequence 1:	NP_001286059.1	Gene:	CG10348 / 35132	FlyBaseID:	FBgn0032707	Length:	540	Species:	Drosophila melanogaster
Sequence 2:	NP_001011332.2	Gene:	LOC496795 / 496795	-ID:	-	Length:	581	Species:	Xenopus tropicalis

Alignment Length:	82	Identity:	37/82 - (45%)
Similarity:	53/82 - (64%)	Gaps:	1/82 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   310 RYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICE 374
            :|.||.||:.|.:|:.|.:|...||||:|:.|..|.:.||.||||..|:| :|..|||:.|.:||
Frog   501 QYECKECGRKFTQSSTLLKHQLIHTGEKPFACSECGKLFSRSSNLIIHLR-MHTGERPYSCTVCE 564

  Fly   375 RCFGQQTNLDRHLKKHE 391
            |.|...::|.:|.|.|:
Frog   565 RSFAHSSHLVKHQKLHK 581

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10348	NP_001286059.1	COG5048	300..>363	CDD:227381	24/52 (46%)
		zf-C2H2	311..333	CDD:278523	9/21 (43%)
		C2H2 Zn finger	313..333	CDD:275368	8/19 (42%)
		zf-H2C2_2	325..349	CDD:290200	9/23 (39%)
		C2H2 Zn finger	341..362	CDD:275368	10/20 (50%)
		zf-H2C2_2	353..377	CDD:290200	12/23 (52%)
		zf-C2H2	368..390	CDD:278523	8/21 (38%)
		C2H2 Zn finger	370..390	CDD:275368	8/19 (42%)
LOC496795	NP_001011332.2	KRAB_A-box	36..96	CDD:383038
		COG5048	173..576	CDD:227381	34/75 (45%)
		C2H2 Zn finger	173..193	CDD:275368
		C2H2 Zn finger	201..221	CDD:275368
		C2H2 Zn finger	229..249	CDD:275368
		C2H2 Zn finger	308..328	CDD:275368
		C2H2 Zn finger	336..356	CDD:275368
		C2H2 Zn finger	364..384	CDD:275368
		C2H2 Zn finger	392..412	CDD:275368
		C2H2 Zn finger	420..440	CDD:275368
		C2H2 Zn finger	448..468	CDD:275368
		C2H2 Zn finger	476..496	CDD:275368
		C2H2 Zn finger	504..524	CDD:275368	8/19 (42%)
		C2H2 Zn finger	532..552	CDD:275368	10/20 (50%)
		C2H2 Zn finger	560..580	CDD:275368	8/19 (42%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910