DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and AgaP_AGAP011409

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_001238000.1 Gene:AgaP_AGAP011409 / 4577549 VectorBaseID:AGAP011409 Length:298 Species:Anopheles gambiae


Alignment Length:128 Identity:30/128 - (23%)
Similarity:47/128 - (36%) Gaps:15/128 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 PHPQLQDYQTRRKNKARTAATGGNATPNLPQRNKDRYTCKFCGKVFPRSANLTRHLRTHTGEQPY 339
            |...:..||..:|      ||..:......:..:.:..|..||.:.   .||.||...||....:
Mosquito   176 PPANIPKYQQIKK------ATHTSKERRAQKMKRKKSLCDMCGSIV---INLQRHTLNHTQAVMH 231

  Fly   340 KCKYCERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHL------KKHESDAVS 396
            .|.||....:..:|:.:|:..:|.|.....|.||.:.|........|:      |.:..|..|
Mosquito   232 GCPYCPIKMTQKTNMVQHIETVHFKTIGKTCCICGKGFVHHKTYSYHMVRAGWTKPYRRDKAS 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 14/62 (23%)
zf-C2H2 311..333 CDD:278523 7/21 (33%)
C2H2 Zn finger 313..333 CDD:275368 7/19 (37%)
zf-H2C2_2 325..349 CDD:290200 9/23 (39%)
C2H2 Zn finger 341..362 CDD:275368 5/20 (25%)
zf-H2C2_2 353..377 CDD:290200 7/23 (30%)
zf-C2H2 368..390 CDD:278523 6/27 (22%)
C2H2 Zn finger 370..390 CDD:275368 6/25 (24%)
AgaP_AGAP011409XP_001238000.1 zf-AD 11..85 CDD:214871
C2H2 Zn finger 233..254 CDD:275368 5/20 (25%)
C2H2 Zn finger 262..279 CDD:275368 4/16 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.