powered by:
Protein Alignment CG10348 and AgaP_AGAP012619
DIOPT Version :9
Sequence 1: | NP_001286059.1 |
Gene: | CG10348 / 35132 |
FlyBaseID: | FBgn0032707 |
Length: | 540 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_001230373.1 |
Gene: | AgaP_AGAP012619 / 4397609 |
VectorBaseID: | AGAP012619 |
Length: | 91 |
Species: | Anopheles gambiae |
Alignment Length: | 63 |
Identity: | 22/63 - (34%) |
Similarity: | 32/63 - (50%) |
Gaps: | 1/63 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 308 KDRYTCKFCGKVFPRSANLTRHLRTHTGE-QPYKCKYCERSFSISSNLQRHVRNIHNKERPFK 369
|...|||.|.|.|........|:.||.|| :.::|..||::|..:..|:.||..:||..:..|
Mosquito 18 KPNKTCKICDKSFIHHKTYRYHMLTHEGEGKTFECPDCEKTFPNAIYLRDHVNRLHNAAKAAK 80
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.