DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and CG12071

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_651832.3 Gene:CG12071 / 43660 FlyBaseID:FBgn0039808 Length:581 Species:Drosophila melanogaster


Alignment Length:403 Identity:94/403 - (23%)
Similarity:139/403 - (34%) Gaps:153/403 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 TWPPPTEQLQLELPHPN--PKLSPVLP----HPQLQDYQTRRK--NKARTAATGGNATPNLPQRN 307
            || ...|||...:|.||  |...|.:.    ||     .:|.|  .:.:.|::|...|......|
  Fly   124 TW-SAAEQLTYNIPKPNLIPFTEPYVEGGSMHP-----ASRLKALQQVQQASSGVRKTNPSKSTN 182

  Fly   308 KDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFS------ISSNLQRHV-------- 358
            | .:.|..|||...|...||.|:|.||||:||.|:.|.::|:      |..|..:||        
  Fly   183 K-AFECTVCGKGLARKDKLTIHMRIHTGEKPYICEVCNKAFARRDKLVIHMNKFKHVTPTNIAPL 246

  Fly   359 -RNIHN----KERP--------------------------------------------------- 367
             :.::|    ||:|                                                   
  Fly   247 GKRLNNMVKKKEQPDPPPEDNKQSLELQLQQQAVQVAAQNIIVQSAQGAPTSIPGIIIPHHQQQL 311

  Fly   368 -FKCEICERCFGQQTNLDRHLKKH-----------ESDAVSLSALSGVSE--------------- 405
             :.||:|.|.|..:.....|.|.|           ||...:.:|...:::               
  Fly   312 SWTCELCGRMFSSRDEWSIHAKSHLEYXQPERLVAESTKPAAAAAGVIAKTTSSNNSRNYQMDAN 376

  Fly   406 ----RMHCIRR----FCEN-----------------PTEESYFEEIRSFM--GKVT--------Q 435
                :|....|    ..:|                 |.::.:.::.:..:  ||..        |
  Fly   377 QNQIQMEAQARKQKIIIQNQMILNASHQQQQQPQQHPQQQQHQQQQQQHVAHGKKAARKHQQHLQ 441

  Fly   436 QQQQQQQQQQHDQQQQQHQSTATSASSSCSSSRDTPTSSHE---EADHAPATS-TADT--AAPSS 494
            ||||||||||..|||||.|::|...:::.||:.:....|.|   ...|..|.| ||.|  .|..|
  Fly   442 QQQQQQQQQQQQQQQQQQQTSAPMYNNNSSSNHNGNNQSQEVSVPVSHIIANSPTAATYMQAQLS 506

  Fly   495 SRDQEEEDSQPIM 507
            ......:...||:
  Fly   507 EHASNMQHGMPIV 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 25/77 (32%)
zf-C2H2 311..333 CDD:278523 9/21 (43%)
C2H2 Zn finger 313..333 CDD:275368 9/19 (47%)
zf-H2C2_2 325..349 CDD:290200 12/23 (52%)
C2H2 Zn finger 341..362 CDD:275368 7/35 (20%)
zf-H2C2_2 353..377 CDD:290200 11/88 (13%)
zf-C2H2 368..390 CDD:278523 7/21 (33%)
C2H2 Zn finger 370..390 CDD:275368 7/19 (37%)
CG12071NP_651832.3 zf-C2H2 185..207 CDD:278523 9/21 (43%)
C2H2 Zn finger 187..207 CDD:275368 9/19 (47%)
zf-H2C2_2 200..224 CDD:290200 13/23 (57%)
C2H2 Zn finger 215..232 CDD:275368 4/16 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.