DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and CG1647

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_651636.1 Gene:CG1647 / 43401 FlyBaseID:FBgn0039602 Length:1222 Species:Drosophila melanogaster


Alignment Length:356 Identity:66/356 - (18%)
Similarity:115/356 - (32%) Gaps:111/356 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 KKCELTWP-----PPTEQLQLELPHPNPKLSPVLPHPQLQDYQTRRKNKARTAATGGNATPNLPQ 305
            :|.|.:||     .|..:.:..:.|...||.|    .|:....::|:.:.:......:.:...|.
  Fly   134 RKGEESWPKNNNVKPQVKKESFVWHKKQKLQP----SQITSLVSKREPEIKDEPAEQDTSLKGPP 194

  Fly   306 RNKDRYT-CKFCGKVF------------------PR----SANLTRH----LRTH-----TGEQP 338
            :...|.: |..||:.|                  ||    :.|.|.|    :|.|     ..:.|
  Fly   195 KKAGRKSICSVCGEKFLSKELADEHKSLVHVPSIPRYICNACNQTHHNQSDIRAHQLWHKLSKTP 259

  Fly   339 YKCKYCERSFSISSNLQRHVRNIHNKERPF-------KCEICERCFGQQTNLDRH---LKKHESD 393
            |||..||.|.:.:....||:|. |....|.       :|.:|::.|......:.|   ::|.:..
  Fly   260 YKCPLCESSVANAYAFTRHLRE-HTPPTPVQLLVLDRECPLCKKTFVTNFFYNTHRCAIRKRKCG 323

  Fly   394 AVSLSALSGVSERMHCIRRFCENPT-EESYFEEIRSFMGKVTQQQQQQQQQQQHDQQ-------- 449
            ..|.:..:..:...|.       || .:.|....:..|.:|...:.|...:.:.:::        
  Fly   324 GCSRTLNTEAAYMRHA-------PTCPKIYLNHSKHIMPQVVTNEAQMLIKNEIEEELLGLPPAT 381

  Fly   450 -----------------------QQQHQSTATS---ASSSCSSSRDTPTSSHEEAD--------- 479
                                   .....|:.|.   |:.|.:|.|.:..:..:..|         
  Fly   382 TVPPDFVIDEGMQPVVVLERLSSPLLRSSSGTDQLVAAKSKNSDRVSARNYLKRVDQLLKNTINT 446

  Fly   480 -----HAPATSTADTAAPSSSRDQEEEDSQP 505
                 |.|.....||..|   |.|.|.|.:|
  Fly   447 LVSIKHEPEVHINDTGPP---RGQAESDPEP 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 23/94 (24%)
zf-C2H2 311..333 CDD:278523 10/48 (21%)
C2H2 Zn finger 313..333 CDD:275368 10/45 (22%)
zf-H2C2_2 325..349 CDD:290200 12/32 (38%)
C2H2 Zn finger 341..362 CDD:275368 7/20 (35%)
zf-H2C2_2 353..377 CDD:290200 7/30 (23%)
zf-C2H2 368..390 CDD:278523 4/31 (13%)
C2H2 Zn finger 370..390 CDD:275368 4/22 (18%)
CG1647NP_651636.1 zf-AD 19..99 CDD:285071
C2H2 Zn finger 203..224 CDD:275368 4/20 (20%)
C2H2 Zn finger 233..253 CDD:275368 5/19 (26%)
C2H2 Zn finger 262..282 CDD:275368 7/20 (35%)
C2H2 Zn finger 297..314 CDD:275368 3/16 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.