DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and CG4374

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001262874.1 Gene:CG4374 / 42767 FlyBaseID:FBgn0039078 Length:772 Species:Drosophila melanogaster


Alignment Length:591 Identity:113/591 - (19%)
Similarity:181/591 - (30%) Gaps:230/591 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 QHQHSHQQHQTLNHHAKGKRRSSFDQPLDLRLAHKRKTDLVDQGPMEDENSNLIMFASELAVAQQ 131
            |.|..||.||...|...|...::                        :.|:|.:....:...:|.
  Fly    60 QQQQHHQNHQQPPHSHNGHNNNN------------------------NNNNNHVQVVHQPITSQS 100

  Fly   132 KEKEL------NNNHIAASLADLGFDMSRKMLRALREGGAGGGGGGGG--------GGGGGGGPP 182
            :::.|      |:|::                  :.:||.||.|||||        .|...||.|
  Fly   101 QQQSLCGGTRTNSNNM------------------IHDGGGGGAGGGGGVVVPVGNRNGTSNGGDP 147

  Fly   183 NAPPLTPPQCSIPAVHPTLLEAM------TKNLPLQYRNVFAG----------VLPGKVNSPAAS 231
            .                  |:..      ..|..|...::|..          |.....|..:||
  Fly   148 T------------------LQGYEFWHQDKDNSRLDSSSIFEDLDRYCWQQQPVTTSASNGGSAS 194

  Fly   232 S---SPTGADFPFRHPLKKCELTWPPPTEQLQLELPHPNPKLSPVLPHPQLQDYQTRRK------ 287
            :   |||.                  |...||.:..|..        |.|||..|.:::      
  Fly   195 TNQPSPTS------------------PQGHLQQQQQHQQ--------HQQLQQQQQQQQQQQPNA 233

  Fly   288 NKARTAATGGNAT----PNLPQRNKDRYTCKFC-----------GKVFPRSANLTRHLRTHTGEQ 337
            |.:..|::|..::    .:|...:...||....           .:..|.|.:|...|.:..|..
  Fly   234 NSSSAASSGAGSSSDTISSLDTTDGQIYTLTVLNGGEPWLKRSESEQLPTSLDLDSLLGSFPGYI 298

  Fly   338 PYKCKYCERSFSIS------------SNLQRHVRNIHNKERPFKCEICE------RCFGQQ---- 380
            ..:..|.:..||..            |::.:........::.....:..      ...|||    
  Fly   299 KSEYPYDDSGFSTDGKDVIGNGTDGLSSISQPQNQGQQAQQTLPSLVTAISLAGGNDLGQQLAQF 363

  Fly   381 --TNLDRHLKKH-----ESDAVSL--SAL--SGVSERMHC-------------IRR--------- 412
              .|.|.|:..|     :|.|.||  |||  .|.::.:|.             :||         
  Fly   364 QNNNNDWHMADHNTETEQSTAESLLRSALQGKGYAKGLHMQNGLTMPVVKDEDMRRLLFADEAAA 428

  Fly   413 --FCENP-TEESYFEEIRSF-MGKVTQQQQQQQQQQQHD-------------------QQQQQHQ 454
              |.::. :....|:|.:.. :....||||||||||.|:                   ...::.:
  Fly   429 LGFADSTLSAAQMFDEAQGIHLSSQQQQQQQQQQQQAHNGNANILVDDMFLSLENAFSDDFEKIK 493

  Fly   455 STATSASSSCSS-SRDTPTSSHEEADHAPATSTADTAAPS---SSRDQEEEDSQPIMELKRTLTS 515
            ..|......||: |..|||    ..|:.|::......:||   :|..|    .||...||..:::
  Fly   494 RIANEVQQFCSAGSSGTPT----PGDYVPSSDVLMQISPSPAVTSAGQ----LQPPQPLKPEVST 550

  Fly   516 KLFPTT 521
            ...||:
  Fly   551 STSPTS 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 12/89 (13%)
zf-C2H2 311..333 CDD:278523 6/32 (19%)
C2H2 Zn finger 313..333 CDD:275368 4/30 (13%)
zf-H2C2_2 325..349 CDD:290200 4/23 (17%)
C2H2 Zn finger 341..362 CDD:275368 4/32 (13%)
zf-H2C2_2 353..377 CDD:290200 0/29 (0%)
zf-C2H2 368..390 CDD:278523 6/33 (18%)
C2H2 Zn finger 370..390 CDD:275368 6/31 (19%)
CG4374NP_001262874.1 zf-C2H2 649..671 CDD:278523
C2H2 Zn finger 651..671 CDD:275370
zf-H2C2_2 663..688 CDD:290200
C2H2 Zn finger 679..699 CDD:275370
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.