DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10348 and CG31365

DIOPT Version :9

Sequence 1:	NP_001286059.1	Gene:	CG10348 / 35132	FlyBaseID:	FBgn0032707	Length:	540	Species:	Drosophila melanogaster
Sequence 2:	NP_732827.1	Gene:	CG31365 / 42736	FlyBaseID:	FBgn0051365	Length:	639	Species:	Drosophila melanogaster

Alignment Length:	135	Identity:	37/135 - (27%)
Similarity:	57/135 - (42%)	Gaps:	10/135 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly   311 YTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIH-NKERPFKCEICE 374
            :.|..|...|.:...|.||:.||||.:.::|..|...|:..||||:|:..:| ...|..||.:|.
  Fly   511 FKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCH 575

  Fly   375 RCFGQQTNLDRHLKKHESDAVSLSALSGVSERMHCIRRFCENPTEESYFEEIRSFMGKVTQQQQQ 439
            |.|...:.|.|||..|.....|..         .|.|:|.:....:.:...:.....|:|....:
  Fly   576 RSFNHVSGLSRHLVTHAGVMFSCK---------QCGRQFNDRSAVQRHVTTMHKVKNKLTDYISE 631

  Fly   440 QQQQQ 444
            ..:.|
  Fly   632 TNEFQ 636

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10348	NP_001286059.1	COG5048	300..>363	CDD:227381	19/52 (37%)
		zf-C2H2	311..333	CDD:278523	6/21 (29%)
		C2H2 Zn finger	313..333	CDD:275368	6/19 (32%)
		zf-H2C2_2	325..349	CDD:290200	9/23 (39%)
		C2H2 Zn finger	341..362	CDD:275368	8/20 (40%)
		zf-H2C2_2	353..377	CDD:290200	10/24 (42%)
		zf-C2H2	368..390	CDD:278523	9/21 (43%)
		C2H2 Zn finger	370..390	CDD:275368	8/19 (42%)
CG31365	NP_732827.1	zf-AD	13..86	CDD:214871
		vATP-synt_E	109..>244	CDD:304907
		RRF	<161..222	CDD:294170
		zf-C2H2_8	454..530	CDD:292531	5/18 (28%)
		C2H2 Zn finger	485..505	CDD:275368
		zf-H2C2_2	497..522	CDD:290200	3/10 (30%)
		C2H2 Zn finger	513..533	CDD:275368	6/19 (32%)
		zf-H2C2_2	526..550	CDD:290200	10/23 (43%)
		C2H2 Zn finger	541..562	CDD:275368	8/20 (40%)
		C2H2 Zn finger	571..591	CDD:275368	8/19 (42%)
		C2H2 Zn finger	598..617	CDD:275368	3/27 (11%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.910