DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and ich

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001262393.1 Gene:ich / 41069 FlyBaseID:FBgn0286204 Length:592 Species:Drosophila melanogaster


Alignment Length:456 Identity:92/456 - (20%)
Similarity:145/456 - (31%) Gaps:167/456 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LIPTSYISHVPYDLA------SSASVAATSSSSTSPTTTSATTTGRLQHQHSHQQHQTLNHHAKG 84
            |...|.:....|.:|      .|.|.:|.:.:.:.|:..:.|...::..          :.|..|
  Fly   183 LFADSQLDSKLYSVADSCVMNGSGSGSAANGNGSGPSIATLTPIDQVAD----------SLHNSG 237

  Fly    85 KRRSSFDQPLDLRLAHKRKTDLVDQGPMEDENSNLIMFASELAVAQQKEKELNN----------- 138
            .|            .:|..|:.||...::|..:.:....::..|..|.:|:.||           
  Fly   238 VR------------IYKDLTEYVDMNSIDDIAAIIGSAIADTTVPNQLDKDDNNDTRDSWMDLDA 290

  Fly   139 ----NHIAA-----------SLAD-------LGFDMSRKMLRAL-----------------REGG 164
                |.|..           ||.|       |....|...|::|                 ..|.
  Fly   291 WIDGNCIQQESAKVLVSQQDSLGDFILPHSPLPMHASSSTLQSLLSHGYMPLLQNRLQNGPPNGN 355

  Fly   165 AGGGGGGGGGGGGGGGPPNAP----------PLTPPQCSIPA-------------VHPTLLEAMT 206
            :.|||||...|.|..|.|.||          ..|...||.|.             ::|..|...|
  Fly   356 SSGGGGGANQGAGIKGDPQAPTSTSYCNELAAATSSSCSPPGSVVSTTDNPNGLMINPRYLSNPT 420

  Fly   207 KN------------------LPLQYRNVFAGVLPGKVNSP-AASSSPTGADFPFRHPLKKCELTW 252
            .|                  |.|:...:.:..|.|  |.| ..::|.||::.....|..|...:.
  Fly   421 NNQATGNLHQQGGYSMQASGLSLKDNGLCSPDLLG--NYPHTTTASTTGSEMRTGAPKAKRSRSQ 483

  Fly   253 PPPTEQLQLELPHPNPKLSPVLPHPQLQDYQTRRKNKARTAATGGNATPNLPQ------------ 305
            ....:|.|                 |.|..|.::.:        |...|..||            
  Fly   484 KKSNQQQQ-----------------QQQQQQQQQGD--------GGGQPTTPQMSAISPSGFSAS 523

  Fly   306 -------RNKDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHN 363
                   :.|..:.|..|.:.|...:|:..||||||||:|::|..|.::|...::|.:| :.||.
  Fly   524 DLSGLLGKEKPVHRCSICNRGFLNKSNIKVHLRTHTGEKPFRCDVCAKAFRQKAHLLKH-QQIHK 587

  Fly   364 K 364
            :
  Fly   588 R 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 23/81 (28%)
zf-C2H2 311..333 CDD:278523 7/21 (33%)
C2H2 Zn finger 313..333 CDD:275368 7/19 (37%)
zf-H2C2_2 325..349 CDD:290200 12/23 (52%)
C2H2 Zn finger 341..362 CDD:275368 5/20 (25%)
zf-H2C2_2 353..377 CDD:290200 4/12 (33%)
zf-C2H2 368..390 CDD:278523
C2H2 Zn finger 370..390 CDD:275368
ichNP_001262393.1 C2H2 Zn finger 538..558 CDD:275368 7/19 (37%)
zf-H2C2_2 550..575 CDD:316026 13/24 (54%)
C2H2 Zn finger 566..586 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.