DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and CG11247

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001097659.1 Gene:CG11247 / 40414 FlyBaseID:FBgn0037120 Length:522 Species:Drosophila melanogaster


Alignment Length:184 Identity:48/184 - (26%)
Similarity:81/184 - (44%) Gaps:53/184 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 YTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICER 375
            :.|:.|...|.:.:....|:|.||||:||:|:.|.::|:.||.|:.|:|. |..|:||:|::||.
  Fly   293 HVCEVCNTYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSSVLKLHIRK-HTGEKPFRCQLCED 356

  Fly   376 --CFGQQTNLDRHLKK-------------HESDAVSLSALSGVSERMHCIRRFCE--------NP 417
              .|.|..:|..|:||             |:...:.:...|.|.   ||.:  |.        |.
  Fly   357 EVAFSQLAHLKNHMKKIHKQQKPYMCEGCHDFFKIKVELQSHVE---HCAK--CPVDGDKPSGNQ 416

  Fly   418 TEESYFEEIRSF-----MGKVTQQQQQQQ-------------------QQQQHD 447
            :|::....:..|     :.|::..|:.:|                   |:|.||
  Fly   417 SEDAQILSVLRFNMAVVLKKISSAQKLRQLGYEKRLIDNVIIASLKLAQRQSHD 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 19/51 (37%)
zf-C2H2 311..333 CDD:278523 5/21 (24%)
C2H2 Zn finger 313..333 CDD:275368 5/19 (26%)
zf-H2C2_2 325..349 CDD:290200 10/23 (43%)
C2H2 Zn finger 341..362 CDD:275368 8/20 (40%)
zf-H2C2_2 353..377 CDD:290200 10/25 (40%)
zf-C2H2 368..390 CDD:278523 10/36 (28%)
C2H2 Zn finger 370..390 CDD:275368 9/34 (26%)
CG11247NP_001097659.1 COG5048 <88..247 CDD:227381
C2H2 Zn finger 95..115 CDD:275368
zf-H2C2_2 107..132 CDD:290200
C2H2 Zn finger 123..144 CDD:275368
C2H2 Zn finger 152..172 CDD:275368
zf-H2C2_2 165..189 CDD:290200
C2H2 Zn finger 180..200 CDD:275368
COG5048 <192..369 CDD:227381 29/76 (38%)
C2H2 Zn finger 210..230 CDD:275370
C2H2 Zn finger 238..260 CDD:275371
C2H2 Zn finger 267..287 CDD:275368
C2H2 Zn finger 295..315 CDD:275368 5/19 (26%)
zf-H2C2_2 309..332 CDD:290200 11/22 (50%)
C2H2 Zn finger 323..343 CDD:275368 8/20 (40%)
C2H2 Zn finger 351..374 CDD:275368 9/22 (41%)
C2H2 Zn finger 382..399 CDD:275368 2/16 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.