DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10348 and CG10654

DIOPT Version :9

Sequence 1:	NP_001286059.1	Gene:	CG10348 / 35132	FlyBaseID:	FBgn0032707	Length:	540	Species:	Drosophila melanogaster
Sequence 2:	NP_001261767.1	Gene:	CG10654 / 39428	FlyBaseID:	FBgn0036294	Length:	412	Species:	Drosophila melanogaster

Alignment Length:	163	Identity:	39/163 - (23%)
Similarity:	63/163 - (38%)	Gaps:	56/163 - (34%)

- Green bases have known domain annotations that are detailed below.

  Fly   305 QRNKDRYT--CKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNK--- 364
            :|...|:|  |:.|.:.|.:.:.|..|::.|.|.:||.|.:|.:|::.::.|:.|:|.:||.
  Fly   218 KRRGVRHTLECRICHRGFYKPSLLEAHMQQHEGLRPYTCVHCAKSYARANLLESHLRQMHNNADA 282

  Fly   365 ----------------ERPFK---------------------CEICERCFGQQTNLDRHLKKHES 392
                            .|..|                     ||.|.:||.::.:|.||...|.|
  Fly   283 ARIIYACPSCNKVYTANRSLKYHMRRTHERYHESESPDARHICEECGKCFARKAHLTRHKMVHGS 347

  Fly   393 DAVSLSALSGVSERMHCIRRFCENPTEESYFEE 425
                      |..|.:|    ||......|.:|
  Fly   348 ----------VEGRRYC----CECCDRRFYTKE 366

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10348	NP_001286059.1	COG5048	300..>363	CDD:227381	18/59 (31%)
		zf-C2H2	311..333	CDD:278523	6/23 (26%)
		C2H2 Zn finger	313..333	CDD:275368	5/19 (26%)
		zf-H2C2_2	325..349	CDD:290200	9/23 (39%)
		C2H2 Zn finger	341..362	CDD:275368	6/20 (30%)
		zf-H2C2_2	353..377	CDD:290200	10/63 (16%)
		zf-C2H2	368..390	CDD:278523	9/42 (21%)
		C2H2 Zn finger	370..390	CDD:275368	8/19 (42%)
CG10654	NP_001261767.1	zf-AD	39..115	CDD:285071
		C2H2 Zn finger	228..248	CDD:275368	5/19 (26%)
		C2H2 Zn finger	256..313	CDD:275368	10/56 (18%)
		C2H2 Zn finger	289..314	CDD:275368	2/24 (8%)
		zf-C2H2	323..345	CDD:278523	8/21 (38%)
		C2H2 Zn finger	325..345	CDD:275368	8/19 (42%)
		C2H2 Zn finger	355..376	CDD:275368	4/12 (33%)
		C2H2 Zn finger	385..405	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0	Normalized mean entropy	S5270
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.950