DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and CG42741

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_611747.2 Gene:CG42741 / 37654 FlyBaseID:FBgn0261705 Length:362 Species:Drosophila melanogaster


Alignment Length:393 Identity:88/393 - (22%)
Similarity:143/393 - (36%) Gaps:94/393 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PYDLASSASVAATSSSSTSPTTTSATTTGRLQHQHSHQQHQTLNHHAKGKRRSSFDQPLDLRLAH 100
            |.||:..:..|:||..|:|.:...::....:.:.         |....|...||.....      
  Fly    26 PVDLSLRSPRASTSHGSSSSSYKFSSANKAVGYS---------NGKPGGSSGSSSSSGF------ 75

  Fly   101 KRKTDLVDQGPMEDENSNLIMFASELAVAQQKEKELNNNHIAASLADLGFDMSRKMLRALREGGA 165
                     |.....:|:|..||     |||:::...::.::.......|..|.......|..|:
  Fly    76 ---------GAGSAGSSSLGAFA-----AQQQQQLYASSGVSKLPFSPFFAASPFFFTYRRISGS 126

  Fly   166 GGGGG------------------GGGGGGGGGGPPNAPPLTPPQCSIPAVHPTLLEAMTKNLPLQ 212
            |.|.|                  .|...||.|...|:......:.|        |.::.|| |.:
  Fly   127 GSGNGTGSVSVKQEDNNNSCSYNNGSSSGGAGSAANSMQDYESKFS--------LLSLFKN-PYK 182

  Fly   213 YRNVFAGVLPGKVNSPAASSSPTGADFPFRHPLKKCELTWPPPTEQLQLELPHPNPKLSPVLPHP 277
            :        .|.....:..:||||..   ..||....    .|:.:.......|:..|:|..  .
  Fly   183 F--------AGGDGQASRKTSPTGGS---SKPLASNS----SPSWKSYAGSGSPHAALNPAF--G 230

  Fly   278 QLQDYQTRRKNKARTAATGG----------------NATPNLPQRNKDRYTC--KFCGKVFPRSA 324
            .:....||:.|.:.:....|                |...|...:|:..:.|  :.|.||:.:|:
  Fly   231 GMGRGATRKDNSSFSGINFGGGGSAFGFTTSSDSMANGGYNDLSKNRKVHKCDTEGCDKVYTKSS 295

  Fly   325 NLTRHLRTHTGEQPYKCKY--CERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHL 387
            :|..|.||||||:||.|.:  |...|:.|..|.||.|. |...:||:|::|.|.|.:..:|..|:
  Fly   296 HLKAHKRTHTGEKPYVCTWEGCIWRFARSDELTRHYRK-HTGVKPFRCQLCTRSFSRSDHLSLHM 359

  Fly   388 KKH 390
            ::|
  Fly   360 RRH 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 25/66 (38%)
zf-C2H2 311..333 CDD:278523 8/23 (35%)
C2H2 Zn finger 313..333 CDD:275368 8/21 (38%)
zf-H2C2_2 325..349 CDD:290200 12/25 (48%)
C2H2 Zn finger 341..362 CDD:275368 8/22 (36%)
zf-H2C2_2 353..377 CDD:290200 10/23 (43%)
zf-C2H2 368..390 CDD:278523 7/21 (33%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
CG42741NP_611747.2 COG5048 <273..>352 CDD:227381 31/79 (39%)
zf-C2H2 280..304 CDD:278523 8/23 (35%)
C2H2 Zn finger 282..304 CDD:275368 8/21 (38%)
zf-H2C2_2 296..>313 CDD:290200 10/16 (63%)
C2H2 Zn finger 312..334 CDD:275368 8/22 (36%)
zf-H2C2_2 326..351 CDD:290200 11/25 (44%)
C2H2 Zn finger 342..362 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.