DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and MESR4

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001097359.1 Gene:MESR4 / 36986 FlyBaseID:FBgn0034240 Length:2171 Species:Drosophila melanogaster


Alignment Length:421 Identity:77/421 - (18%)
Similarity:133/421 - (31%) Gaps:153/421 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 YRNVFAGVLPGKVNSPAASSSPTGA--DFPFRHPLKKCELTWPPPTEQLQLELPHPNPKLSPVLP 275
            |..:...:.||:|         .|:  |..||..|  |::...|...:|.:.|...:......  
  Fly  1170 YSEILCHICPGEV---------AGSVYDLQFRCCL--CDMAPLPSAFRLMVHLRKQHQACDIC-- 1221

  Fly   276 HPQLQDYQTRRKNKARTAATGGNATPNLPQRNKDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYK 340
               |:|.|::.|..:..            .::|..:.|..||..:....::::||....|.:...
  Fly  1222 ---LEDCQSQSKLSSHV------------WKHKLLHLCYRCGIAYRNKQDISKHLFWKHGTESAG 1271

  Fly   341 CKYCERSFSISSNLQRHVRNIHNKERP---FKCEICERCFGQQTNLDRHLKKHESDAVSLSALSG 402
            ||.|         ||:..|::::...|   |.||.|...|.:...|:.|.:.|..|.        
  Fly  1272 CKQC---------LQKRWRHVYHFCVPPAEFPCEQCGFVFSKAIYLEVHQRMHTGDF-------- 1319

  Fly   403 VSERMHCIRRFCEN---------------------------------PTEESYFEEIRSFMGKVT 434
               |..|....||.                                 |||:  .|:|:..:    
  Fly  1320 ---RYACTEEGCEEKFVSRKLLLKHASSHVAKELPQAVSVEQTADAAPTEK--LEDIKEEL---- 1375

  Fly   435 QQQQQQQQQQQHDQQQQQHQS-------------------------------------------- 455
             ::.:.:::..|:|::...:|                                            
  Fly  1376 -EEGEDEKEGAHNQEKLLSESLTNNETPKKEESDRIDNSIEPPLSKSENRKRRKKSKRNKESLED 1439

  Fly   456 ------TATSASSSCSSSRDTPTSSHEEADHAPATSTAD-------TAAPSSSRDQEEEDSQPIM 507
                  ..:.:.||..|..|.|.|||:|....|..|:.|       ..:|||..|.:|.|.:..:
  Fly  1440 LNLIAPNLSESDSSDDSDSDAPRSSHQEQPKLPMRSSVDDLDMPKVMLSPSSESDADELDGKSKL 1504

  Fly   508 ELKRTLTSKLFPTTTADSAMTTPQTTSIKEE 538
            |.|.   .|....:|.:.|:........|:|
  Fly  1505 EDKE---EKPLDGSTEEKALDADDELEPKKE 1532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 13/62 (21%)
zf-C2H2 311..333 CDD:278523 5/21 (24%)
C2H2 Zn finger 313..333 CDD:275368 5/19 (26%)
zf-H2C2_2 325..349 CDD:290200 6/23 (26%)
C2H2 Zn finger 341..362 CDD:275368 6/20 (30%)
zf-H2C2_2 353..377 CDD:290200 8/26 (31%)
zf-C2H2 368..390 CDD:278523 7/21 (33%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
MESR4NP_001097359.1 C2H2 Zn finger 1272..1288 CDD:275368 6/24 (25%)
C2H2 Zn finger 1295..1315 CDD:275370 6/19 (32%)
C2H2 Zn finger 1323..1341 CDD:275370 3/17 (18%)
PHD_ING 2110..2156 CDD:276980
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.