DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and CG4282

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_611118.3 Gene:CG4282 / 36825 FlyBaseID:FBgn0034114 Length:652 Species:Drosophila melanogaster


Alignment Length:172 Identity:38/172 - (22%)
Similarity:65/172 - (37%) Gaps:39/172 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 CGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNK---ERPFKCEICERCF 377
            ||:.|.:...|..|:..|.....:||..||:||..|.:|:.| :.:|..   :..|.|::|.:.|
  Fly   361 CGRKFTQRKVLAEHVLVHWNPDHFKCSVCEKSFQNSRHLESH-QQVHMDPAVKLTFSCDLCSKTF 424

  Fly   378 GQQTNLDRH-LKKHESDAVSLSALSGVSERMHCIRRFCENPTEESYFEEIRSFMGKVTQQQQQQQ 441
            ..:|.:|.| |.||...:......|      .|.::|                   :|:::.:..
  Fly   425 LSKTAIDYHKLNKHVPKSEFKFTCS------ECNKKF-------------------LTERKLKNH 464

  Fly   442 QQQQHDQQQQQHQSTATSASSSCSSSRDTP--TSSHEEADHA 481
            ....||.:       :|.....|.....|.  ...|:|..|:
  Fly   465 MSSMHDPE-------STIICDKCGKQMRTKIILKKHQELMHS 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 15/46 (33%)
zf-C2H2 311..333 CDD:278523 5/16 (31%)
C2H2 Zn finger 313..333 CDD:275368 5/16 (31%)
zf-H2C2_2 325..349 CDD:290200 8/23 (35%)
C2H2 Zn finger 341..362 CDD:275368 8/20 (40%)
zf-H2C2_2 353..377 CDD:290200 6/26 (23%)
zf-C2H2 368..390 CDD:278523 8/22 (36%)
C2H2 Zn finger 370..390 CDD:275368 7/20 (35%)
CG4282NP_611118.3 zf-AD 7..81 CDD:285071
FYDLN_acid <191..268 CDD:302856
C2H2 Zn finger 330..351 CDD:275368
C2H2 Zn finger 360..378 CDD:275368 5/16 (31%)
LIM 361..>400 CDD:295319 13/38 (34%)
C2H2 Zn finger 386..406 CDD:275368 8/20 (40%)
zf-C2H2_8 389..465 CDD:292531 22/101 (22%)
C2H2 Zn finger 417..438 CDD:275368 7/20 (35%)
C2H2 Zn finger 448..465 CDD:275368 4/41 (10%)
C2H2 Zn finger 477..498 CDD:275368 4/20 (20%)
C2H2 Zn finger 511..532 CDD:275368
C2H2 Zn finger 541..562 CDD:275368
C2H2 Zn finger 570..590 CDD:275368
C2H2 Zn finger 598..619 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.