DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and CG8388

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_611075.1 Gene:CG8388 / 36763 FlyBaseID:FBgn0034062 Length:572 Species:Drosophila melanogaster


Alignment Length:262 Identity:59/262 - (22%)
Similarity:102/262 - (38%) Gaps:55/262 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 PLKKCELTWPPP-TEQLQLELPHPN--PKLSPVLPHPQLQDYQTRRKNKARTAA-------TGGN 298
            |...||.|:|.. |.|..::|.|.|  .|:..|          ..:..:.|.|.       ||| 
  Fly   349 PCTHCEKTYPSQYTMQQHVKLVHLNLYAKICDV----------CGKSIRGREALARHMEEHTGG- 402

  Fly   299 ATPNLPQRNKDRYTCKFCGKVFPRSANLTRHLR-THTGE--QPYKCKYCERSFSISSNLQRHVRN 360
                 ||.   ...|..|..:......|.||:: .||.|  ||.:|::|.:........|.|::.
  Fly   403 -----PQA---AIKCHLCDSMLTTKYGLARHIKMMHTAENLQPMQCEFCLKICPSLQAHQHHIKY 459

  Fly   361 IHNKERPFKCEICERCFGQQTNLDRHLKKHESDAVSLSALSGVSERMHCIRRFCENPTEESYFEE 425
            .||..|..:|.:||:.|.:...|..|:..|..:.:....        ||.:.|..|....::.::
  Fly   460 THNTARSHQCPMCEKAFKRPNELKEHMTTHTGEVLYTCP--------HCPQTFNSNANMHAHRKK 516

  Fly   426 IRSFMGKVTQQQQQQQQQQQHDQQQQQHQSTATSASSSCSSSRDTPTSSHEEADHAPATSTADTA 490
            :          .:::.::.:|.:..:..:|....|    .|.|.| |.:.::....||.:.|.|:
  Fly   517 V----------HRKEWEENRHKRLNRSRKSDTIIA----VSVRKT-TETRQDGGLVPAEAIATTS 566

  Fly   491 AP 492
            :|
  Fly   567 SP 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 16/65 (25%)
zf-C2H2 311..333 CDD:278523 5/22 (23%)
C2H2 Zn finger 313..333 CDD:275368 5/20 (25%)
zf-H2C2_2 325..349 CDD:290200 10/26 (38%)
C2H2 Zn finger 341..362 CDD:275368 4/20 (20%)
zf-H2C2_2 353..377 CDD:290200 8/23 (35%)
zf-C2H2 368..390 CDD:278523 6/21 (29%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
CG8388NP_611075.1 zf-AD <21..77 CDD:285071
C2H2 Zn finger 264..281 CDD:275368
C2H2 Zn finger 289..309 CDD:275368
C2H2 Zn finger 320..340 CDD:275368
C2H2 Zn finger 350..369 CDD:275368 6/18 (33%)
C2H2 Zn finger 440..461 CDD:275368 4/20 (20%)
C2H2 Zn finger 469..489 CDD:275368 6/19 (32%)
C2H2 Zn finger 497..515 CDD:275368 4/25 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.