DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and Sp6

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001102303.1 Gene:Sp6 / 363672 RGDID:1306768 Length:376 Species:Rattus norvegicus


Alignment Length:341 Identity:75/341 - (21%)
Similarity:111/341 - (32%) Gaps:134/341 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 GGGGGGPPNAPPLTPPQCSIPAVHP----TLLEAMTKNLPLQYRNVFAGVLPGKVNS-------- 227
            |..|....:||..:||:..:..:..    |..||.....|||         ||::.|        
  Rat     7 GSLGSQHTDAPHSSPPRLDLQPLQTYQGHTSPEAGDYPSPLQ---------PGELQSLPLGPEVD 62

  Fly   228 -------PAASSSPTGADFPFRHPLKK---CELTWP--------------PPTEQ---------- 258
                   |.|||..|..|.....||..   .:|..|              |.||.          
  Rat    63 FSQGYELPGASSRVTCEDLESDSPLAPGPFSKLLQPDMSHHYESWFRPTHPGTEDGSWWDLHPGT 127

  Fly   259 LQLELPHPNPKLS------------------------PVLPHPQ--------------------L 279
            ..::|||....|:                        |..|||.                    |
  Rat   128 SWMDLPHTQGALTSPGHPGALQPALGGYVGDHQLCAPPPHPHPHHLLPAAGGQHLLGPPDGAKVL 192

  Fly   280 Q-------------DYQTRRKNKARTAATGGNAT----PNLPQ-------------RNKDRYTCK 314
            :             |...|.|...|:.......|    ||..:             :.|..:.|.
  Rat   193 EAAAPESQGLDSSLDAAARPKGSRRSVPRSSGQTVCRCPNCLEAERLGAPCGPDGGKKKHLHNCH 257

  Fly   315 F--CGKVFPRSANLTRHLRTHTGEQPYKCK--YCERSFSISSNLQRHVRNIHNKERPFKCEICER 375
            .  |||.:.::::|..|||.|:|::|:.|.  :|.:.|:.|..||||::. |...:.|.|.:|.|
  Rat   258 IPGCGKAYAKTSHLKAHLRWHSGDRPFVCNWLFCGKRFTRSDELQRHLQT-HTGTKKFPCAVCSR 321

  Fly   376 CFGQQTNLDRHLKKHE 391
            .|.:..:|.:|:|.||
  Rat   322 VFMRSDHLAKHMKTHE 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 23/83 (28%)
zf-C2H2 311..333 CDD:278523 8/23 (35%)
C2H2 Zn finger 313..333 CDD:275368 8/21 (38%)
zf-H2C2_2 325..349 CDD:290200 9/25 (36%)
C2H2 Zn finger 341..362 CDD:275368 8/22 (36%)
zf-H2C2_2 353..377 CDD:290200 9/23 (39%)
zf-C2H2 368..390 CDD:278523 8/21 (38%)
C2H2 Zn finger 370..390 CDD:275368 7/19 (37%)
Sp6NP_001102303.1 C2H2 Zn finger 259..278 CDD:275368 7/18 (39%)
COG5048 <261..>336 CDD:227381 27/75 (36%)
zf-H2C2_2 270..297 CDD:290200 10/26 (38%)
C2H2 Zn finger 286..308 CDD:275368 8/22 (36%)
zf-H2C2_2 300..323 CDD:290200 9/23 (39%)
zf-C2H2 314..336 CDD:278523 8/21 (38%)
C2H2 Zn finger 316..336 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.