DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and Zic5

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001382593.1 Gene:Zic5 / 361095 RGDID:1310160 Length:623 Species:Rattus norvegicus


Alignment Length:433 Identity:103/433 - (23%)
Similarity:151/433 - (34%) Gaps:141/433 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 REKDHSPRKMLPSPKQGCVYPALGLIPTSYISHVPYDLASSASVAATSSSSTSPTTTSATTTGRL 66
            |....||:...|.|     :|| |:..::..::...|...||...|...|..:|.          
  Rat   200 RSGSSSPQHPTPPP-----HPA-GMFISASGTYAGRDGGGSALFPALHDSPGAPG---------- 248

  Fly    67 QHQHSHQQHQTLNHHAKGKRRSSFDQPLDLRLAHKRKTDLVDQ-----GPME-DENSNLIMFASE 125
                        .|...|:.|      |.|..|.....:|..:     .|.. |.:...:..|:.
  Rat   249 ------------GHPLNGQMR------LGLAAAAAAAAELYGRAEPPFAPRSGDAHYGAVAAAAA 295

  Fly   126 LAVAQQKEKELNNNHIAASLADLGFDMSRKMLRALREGGAGGGGGGGGGGGGGGGP---PNAPPL 187
            .|:.......||.|..||:.|                           ....|.||   .:|||.
  Rat   296 AALHGYGAVNLNLNLAAAAAA---------------------------AAAAGPGPHLQHHAPPP 333

  Fly   188 TPPQCSIPAVHPTLLEAMTKNLPLQYRNVFAGVLPGKVNSPAASSSPTGADFPF-RHPLKK---C 248
            .||..  ||.||        :.|         .|||          ..||...: |.|:|:   |
  Rat   334 APPPA--PAPHP--------HHP---------HLPG----------AAGAFLRYMRQPIKRELIC 369

  Fly   249 ELTWPPPTEQLQLELPHPNPKLSPVLPHPQLQDYQTRRKNKARTAATGGNAT-------PNLPQR 306
            :  |..|.|   |..| |.|..|...|..:.........|.......||...       .:.|:.
  Rat   370 K--WLDPEE---LAGP-PAPADSGAKPCSKTFGTMHELVNHVTVEHVGGPEQSSHVCFWEDCPRE 428

  Fly   307 NK------------------DRYTCKF--CGKVFPRSANLTRHLRTHTGEQPYKCKY--CERSFS 349
            .|                  ..:.|.|  |||||.||.||..|.||||||:|:||::  |:|.|:
  Rat   429 GKPFKAKYKLINHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRKFA 493

  Fly   350 ISSNLQRHVRNIHNKERPFKCEI--CERCFGQQTNLDRHLKKH 390
            .||:.::| .::|..::|:.|:|  |::.:...::|.:|:|.|
  Rat   494 NSSDRKKH-SHVHTSDKPYYCKIRGCDKSYTHPSSLRKHMKIH 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 29/91 (32%)
zf-C2H2 311..333 CDD:278523 13/23 (57%)
C2H2 Zn finger 313..333 CDD:275368 13/21 (62%)
zf-H2C2_2 325..349 CDD:290200 14/25 (56%)
C2H2 Zn finger 341..362 CDD:275368 7/22 (32%)
zf-H2C2_2 353..377 CDD:290200 6/25 (24%)
zf-C2H2 368..390 CDD:278523 6/23 (26%)
C2H2 Zn finger 370..390 CDD:275368 6/21 (29%)
Zic5NP_001382593.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.