DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and CG12769

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001286181.1 Gene:CG12769 / 35770 FlyBaseID:FBgn0033252 Length:713 Species:Drosophila melanogaster


Alignment Length:515 Identity:108/515 - (20%)
Similarity:149/515 - (28%) Gaps:223/515 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PSPKQGCVYPALGLI----PT--SYISHVPYDLASSASVAATSSSS-----TSPTTTSAT-TTGR 65
            |||..|.     |:|    ||  :.:.|....|.|....|:::|.|     .|||.|... :|| 
  Fly    19 PSPTVGG-----GIIVDMTPTTAALLHHNAMALRSLKDAASSASESELQEPRSPTPTPTNLSTG- 77

  Fly    66 LQHQHSHQQHQTLNHHAKGKRRSSFDQPLDLRLAHKRKTDLVDQGPMEDENSNLIMFASELAVAQ 130
                 .|....|.    :.:|..||:                     ....::|::...:....|
  Fly    78 -----PHSPPMTF----RCERCDSFE---------------------TSSRASLLLHVVQCLAGQ 112

  Fly   131 QKEKELNNNHIAASLADLGFDMSRKMLRALRE------GGAGGGGGGGGGGGGGGGPPNAPPLTP 189
                       ||:.|......:|.....|:|      |...||.|.|..|.|            
  Fly   113 -----------AAAAAAAAAASARLKSEDLQEPENMSLGHMEGGKGDGQTGNG------------ 154

  Fly   190 PQCSIPAVHPTLLEAMTKNLPLQYRNVFAGVLPGKVNSPAASSSPTGADFPFRHPLKKCELTWPP 254
                                                :|.:|||||.|                  
  Fly   155 ------------------------------------SSSSASSSPAG------------------ 165

  Fly   255 PTEQLQLELPHPNPKLSPVLPHPQLQDYQTRRKNKARTAATGGNATPNLPQRNKDRYTCKFCGKV 319
                                             |..  ...|||::      ::..:.|..|...
  Fly   166 ---------------------------------NSG--GGGGGNSS------SRKVFECDVCNMK 189

  Fly   320 FPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLD 384
            |...||:.||...|||.:||:|:.|::.|....:|..|. ..|.|..|:.|.||.|.|.:|..:.
  Fly   190 FSNGANMRRHKMRHTGVKPYECRVCQKRFFRKDHLAEHF-TTHTKTLPYHCPICNRGFQRQIAMR 253

  Fly   385 RHLKKH---ESDAV------SLSALSGVSERMHCIRRF---CENP-------------------- 417
            .|.:..   :.|.|      |..|.|..|.|:|...|.   .:||                    
  Fly   254 AHFQNEHVGQHDLVKTCPLCSYRAGSMKSLRIHFFNRHGIDLDNPGPGGTSSLLLALESQASAAA 318

  Fly   418 --TEESYFEEIRSFMGKVTQQQQQQQQQQQHDQQQQQHQSTATSASSSCSSSRD----TP 471
              ...||   :...:..|..|.|.|||||         |..|..||.|..|.|.    ||
  Fly   319 AAAAASY---VPPGLSPVPVQSQSQQQQQ---------QQVAPPASDSGESMRSLENATP 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 17/62 (27%)
zf-C2H2 311..333 CDD:278523 7/21 (33%)
C2H2 Zn finger 313..333 CDD:275368 7/19 (37%)
zf-H2C2_2 325..349 CDD:290200 10/23 (43%)
C2H2 Zn finger 341..362 CDD:275368 5/20 (25%)
zf-H2C2_2 353..377 CDD:290200 9/23 (39%)
zf-C2H2 368..390 CDD:278523 7/21 (33%)
C2H2 Zn finger 370..390 CDD:275368 7/19 (37%)
CG12769NP_001286181.1 C2H2 Zn finger 183..203 CDD:275368 7/19 (37%)
zf-H2C2_2 195..218 CDD:290200 10/22 (45%)
C2H2 Zn finger 211..231 CDD:275368 5/20 (25%)
C2H2 Zn finger 239..255 CDD:275368 6/15 (40%)
C2H2 Zn finger 662..689 CDD:275371
C2H2 Zn finger 690..712 CDD:275371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.