DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and CG30431

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster


Alignment Length:270 Identity:71/270 - (26%)
Similarity:108/270 - (40%) Gaps:59/270 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 GPPNAPPLTPPQCSIPAVH-PTLLEAM-------------TKNLPLQYRNVFAGVLPGKVNSPAA 230
            |....|...|.|.|.|..| ..|:|.:             ..::|..:.   :.|..|.:|:|  
  Fly   112 GSLEGPMSVPLQASKPVAHVAPLMETVDFESLDFQDSSHSEHDIPSYWE---SSVDSGSLNTP-- 171

  Fly   231 SSSPTGADFPFRHPLKKCEL-TWPPPTEQLQLELPHPN----PKLSPVLPHPQLQDYQTRRKNKA 290
                       .|..:..|| ...|||.....|.|.|:    ||:....|.      |...|.|.
  Fly   172 -----------HHQPETAELFAVEPPTPPESSEEPAPDAAEKPKMRRARPR------QDNVKPKE 219

  Fly   291 RTAATGGNATPNLPQRNKDRYTCKFCGKVFPRSANLTRHL-RTH-TGEQPYKCKYCERSFSISSN 353
            |.|:  |...|      :..:.|..|.|.|.|:..|..|: ..| .||..|:|:.|.::|:...:
  Fly   220 RKAS--GAVHP------RSLHPCPECEKKFTRNFQLKLHMTAVHGMGEMRYQCEECRKNFASRHS 276

  Fly   354 LQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKKHESDAVSLSALSGVSERMHCIRRFCENPT 418
            |:.||:::|:.||||.|:.|:|.|..:|.|..||:.|..:     |...:.|...|.:.:   ||
  Fly   277 LRYHVKSVHSTERPFGCQHCDRRFILRTQLLSHLRTHTGE-----AKPRIFECQRCSKSW---PT 333

  Fly   419 EESYFEEIRS 428
            :......:||
  Fly   334 KSDLRTHMRS 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 18/64 (28%)
zf-C2H2 311..333 CDD:278523 7/22 (32%)
C2H2 Zn finger 313..333 CDD:275368 7/20 (35%)
zf-H2C2_2 325..349 CDD:290200 8/25 (32%)
C2H2 Zn finger 341..362 CDD:275368 6/20 (30%)
zf-H2C2_2 353..377 CDD:290200 11/23 (48%)
zf-C2H2 368..390 CDD:278523 9/21 (43%)
C2H2 Zn finger 370..390 CDD:275368 8/19 (42%)
CG30431NP_610211.1 zf-AD 11..82 CDD:285071
C2H2 Zn finger 234..255 CDD:275368 7/20 (35%)
C2H2 Zn finger 264..285 CDD:275368 6/20 (30%)
C2H2 Zn finger 293..313 CDD:275368 8/19 (42%)
zf-C2H2_8 305..373 CDD:292531 11/47 (23%)
C2H2 Zn finger 324..344 CDD:275368 5/23 (22%)
C2H2 Zn finger 354..374 CDD:275368
zf-H2C2_2 366..389 CDD:290200
C2H2 Zn finger 382..403 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.