DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and CG17328

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster


Alignment Length:133 Identity:46/133 - (34%)
Similarity:62/133 - (46%) Gaps:23/133 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 PVLPHPQLQD--------------YQTRRKNKARTAATGGNATPNLPQRNKDRYTCKFCGKVFPR 322
            |:||.....:              ||  ||........|....|.:|      :||..|.|.|..
  Fly   102 PLLPQRDSDEEEPVDAKVSKRRSRYQ--RKPPEEHKKRGPKPVPKMP------HTCYECHKSFKC 158

  Fly   323 SANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHL 387
            .|.||:|:||||||:||:|.:|.:.|:...||:.|.|. |..::||:||||.:.|....|...|.
  Fly   159 IAQLTQHIRTHTGEKPYQCSFCIQRFAQKYNLKVHERT-HTGDKPFQCEICSKQFSALGNFQAHQ 222

  Fly   388 KKH 390
            |.|
  Fly   223 KIH 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 26/62 (42%)
zf-C2H2 311..333 CDD:278523 10/21 (48%)
C2H2 Zn finger 313..333 CDD:275368 9/19 (47%)
zf-H2C2_2 325..349 CDD:290200 13/23 (57%)
C2H2 Zn finger 341..362 CDD:275368 7/20 (35%)
zf-H2C2_2 353..377 CDD:290200 11/23 (48%)
zf-C2H2 368..390 CDD:278523 9/21 (43%)
C2H2 Zn finger 370..390 CDD:275368 8/19 (42%)
CG17328NP_609786.2 zf-AD 8..80 CDD:214871
COG5048 146..>211 CDD:227381 32/71 (45%)
C2H2 Zn finger 149..169 CDD:275368 9/19 (47%)
C2H2 Zn finger 177..197 CDD:275368 7/20 (35%)
zf-H2C2_2 189..213 CDD:404364 11/24 (46%)
C2H2 Zn finger 205..225 CDD:275368 8/19 (42%)
C2H2 Zn finger 233..253 CDD:275368
zf-H2C2_2 245..270 CDD:404364
C2H2 Zn finger 261..282 CDD:275368
C2H2 Zn finger 318..338 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.