DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and Cf2

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster


Alignment Length:376 Identity:84/376 - (22%)
Similarity:143/376 - (38%) Gaps:105/376 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LASSASVAATSSSSTSPTTTSATTTGRL------------QHQHSHQQHQTLNHHAKGKRRSSFD 91
            :.::|.:||...........:.|...:|            :.||..||.|..:||.:..::....
  Fly   183 ICTTAMLAAGQQGFMEQQEAAVTPDDQLPAMAPRDMRLTPEEQHHQQQLQAEHHHQQQHQQQQQQ 247

  Fly    92 QPLDLRLAHKRKTDLVDQGPMEDENSNLIMFASELAVAQQKEKELNNNHIAASLADLGFDMSRKM 156
            |.....|..:::.::.:|...:..:.:            |::::|..:.:|..:..|...:::  
  Fly   248 QQQQQELLEQQQREMQEQAQQQQVHHH------------QQDQDLAGDQVALKVPPLTVKLNK-- 298

  Fly   157 LRALREGGAGGGGGGGGGGGGGGGPPNAPPLTPPQCSIPAVHPTLLEA--MTKNLPLQYRNVFAG 219
                   .|.||.                .::.||..|.....:|.::  :..::|:.......|
  Fly   299 -------NANGGA----------------IVSHPQVIIKEEPLSLSDSGDVVNSVPVYAIQANPG 340

  Fly   220 VLPGKVNSPAASSS---------PTGADFPFRHPLKKCELTWPPPTEQLQLELPHPNPKLSPVLP 275
            |       ||.:||         |.......||....|..|:..|               ..:..
  Fly   341 V-------PAPASSGVLVGTQTVPADLAHKIRHKCPDCPKTFKTP---------------GTLAM 383

  Fly   276 HPQLQDYQTRRKNKARTAATG-GNATPNLPQRNKDR-YTCKFCGKVFPRSANLTRHLRTHTGEQP 338
            |              |...|| .:|||      |:| |||.:|||.|.:|..|.:|.|.||||:|
  Fly   384 H--------------RKIHTGEADATP------KERPYTCSYCGKSFTQSNTLKQHTRIHTGEKP 428

  Fly   339 YKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKK 389
            :.|.|||:|||:...|.:|:|. |..|:|:.|..|::.|.|::.|..|..|
  Fly   429 FHCGYCEKSFSVKDYLTKHIRT-HTGEKPYTCPYCDKRFTQRSALTVHTTK 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 30/63 (48%)
zf-C2H2 311..333 CDD:278523 11/21 (52%)
C2H2 Zn finger 313..333 CDD:275368 9/19 (47%)
zf-H2C2_2 325..349 CDD:290200 13/23 (57%)
C2H2 Zn finger 341..362 CDD:275368 10/20 (50%)
zf-H2C2_2 353..377 CDD:290200 8/23 (35%)
zf-C2H2 368..390 CDD:278523 7/22 (32%)
C2H2 Zn finger 370..390 CDD:275368 7/20 (35%)
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 46/142 (32%)
C2H2 Zn finger 368..388 CDD:275368 5/48 (10%)
C2H2 Zn finger 403..423 CDD:275368 9/19 (47%)
C2H2 Zn finger 431..451 CDD:275368 10/20 (50%)
zf-H2C2_2 443..468 CDD:316026 9/25 (36%)
C2H2 Zn finger 459..480 CDD:275368 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.