DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and bowl

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001245861.1 Gene:bowl / 33602 FlyBaseID:FBgn0004893 Length:744 Species:Drosophila melanogaster


Alignment Length:599 Identity:139/599 - (23%)
Similarity:188/599 - (31%) Gaps:237/599 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SSASVAATSSSSTSPTTTSATTTGRLQHQHSHQQHQTLNHHAKGKRRSSFDQPLDLRLAHKRKTD 105
            |..|...:.:.:.....:||:.....:.|.::|||....|          ..|.....:|.|:  
  Fly    55 SGGSDGGSQNGNGDSRNSSASRISAYETQLAYQQHLAGLH----------GPPPPPPPSHHRE-- 107

  Fly   106 LVDQGPMEDENSNLIMFASELAVAQQKEKELNNNHIAASLADLGFDMSRKMLRALREGGAGGGGG 170
                         :..|...|...:.:....:|..|.|.:||     .||.| ||||..|.....
  Fly   108 -------------ISAFVPVLPTGKVRPGSNSNYEIIAMMAD-----KRKEL-ALREAAAAAAML 153

  Fly   171 GGGGGGGGGGPPNAPPLTPPQCSIPAVHPTLLEAMTKNLPLQYRNVFAGVLPGKVNSP------A 229
            |.|.||.||  |..||                               .|||.|....|      .
  Fly   154 GRGPGGPGG--PGVPP-------------------------------PGVLYGPAGVPPPPYLTG 185

  Fly   230 ASSSPTGA-DFPFRHPLKKCELTWPPPTEQLQLELPHPNPKLSPVLPHPQLQDYQTRRKNKARTA 293
            ...||||| .|||            ||........|   |.|.|.: |..|.    ||..:|   
  Fly   186 PGPSPTGAGSFPF------------PPGAAAAALFP---PGLGPGM-HAGLD----RRLLRA--- 227

  Fly   294 ATGGNATPNLPQRNKDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHV 358
                   |....|.|.::.||||.:.|.:|.||..|.||||.|:||.|..|.::|....:|:.| 
  Fly   228 -------PGRASRPKKQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDH- 284

  Fly   359 RNIHNKERPF----------------------------KCEICERCFGQQTNLDRHLKKH----- 390
            |.||:||:||                            ||.:|.|.|.|::||..||..|     
  Fly   285 RYIHSKEKPFKCTECGKGFCQSRTLAVHKILHMEESPHKCPVCSRSFNQRSNLKTHLLTHTDHKP 349

  Fly   391 --------------------------------------ESDAVSLS------------------- 398
                                                  |.:|.:||                   
  Fly   350 YECSSCGKVFRRNCDLRRHALTHAVGEVNSGDYVDVGEEDEARNLSGDEEDSLLEVDSPRQSPVH 414

  Fly   399 --ALSG------VSERMHCIRRFCENPTEESYFEEIRSFMGKVTQQQQQQQQQQQHDQQQQQ--- 452
              ..||      .||||. ::|......|||. ||...|    .::::.|...:.||..:::   
  Fly   415 NLGESGGSGEKSESERMR-LKRKAAIDHEESE-EEFDDF----DEEEELQDLPRVHDLPREEDDD 473

  Fly   453 ----------------HQSTATSASSSCSSS------RDTPTSSHEEADHAPATSTADTAAPSSS 495
                            .|::..:|:|..|||      |...|..|.|.      ....|..|...
  Fly   474 FDPEDEEQAEVALVARFQASKAAATSQSSSSVGTKPERQGVTHCHHEG------GETYTMRPHGE 532

  Fly   496 RDQEEEDSQPIMEL 509
            :.|||..:..|..|
  Fly   533 KHQEEPGNSGIASL 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 26/62 (42%)
zf-C2H2 311..333 CDD:278523 10/21 (48%)
C2H2 Zn finger 313..333 CDD:275368 10/19 (53%)
zf-H2C2_2 325..349 CDD:290200 12/23 (52%)
C2H2 Zn finger 341..362 CDD:275368 6/20 (30%)
zf-H2C2_2 353..377 CDD:290200 13/51 (25%)
zf-C2H2 368..390 CDD:278523 11/49 (22%)
C2H2 Zn finger 370..390 CDD:275368 9/19 (47%)
bowlNP_001245861.1 COG5048 <232..372 CDD:227381 41/140 (29%)
C2H2 Zn finger 240..260 CDD:275368 10/19 (53%)
zf-H2C2_2 252..277 CDD:290200 13/24 (54%)
C2H2 Zn finger 268..288 CDD:275368 6/20 (30%)
zf-H2C2_2 280..303 CDD:290200 9/23 (39%)
C2H2 Zn finger 296..316 CDD:275368 0/19 (0%)
zf-C2H2 322..344 CDD:278523 10/21 (48%)
C2H2 Zn finger 324..344 CDD:275368 9/19 (47%)
zf-H2C2_2 336..361 CDD:290200 5/24 (21%)
C2H2 Zn finger 352..372 CDD:275368 0/19 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.